Align gamma-glutamyl-gamma-aminobutyraldehyde dehydrogenase (EC 1.2.1.54) (characterized)
to candidate WP_008343682.1 BA79_RS18445 aldehyde dehydrogenase family protein
Query= reanno::WCS417:GFF5420 (497 letters) >NCBI__GCF_000691145.1:WP_008343682.1 Length = 475 Score = 296 bits (758), Expect = 1e-84 Identities = 186/482 (38%), Positives = 279/482 (57%), Gaps = 19/482 (3%) Query: 16 LKIEGRAYINGEYTAAVSGDTFECISPVDGRLLATVASCDAADAQRAVENARATFNSGVW 75 ++ + + +INGE+ A+ +T E I+P ++ T++ D +AV+ ARA F S + Sbjct: 1 MRNQEKHFINGEWVASTGNETTEVINPATEEVIGTISLGTKEDLDKAVKAARAAFPS--F 58 Query: 76 SRLAPAKRKSAMLRFAALLKANAEELALLETLDMGKPISDSLNIDVPGAANALSWSGEAI 135 S+ + +R + + +EL + T ++G P+ S + S + EA+ Sbjct: 59 SKTSRNERVEMLENIVRGYEKRKDELVEVMTKELGAPLKVSEEVHYKMGYEHFSKAAEAL 118 Query: 136 DKIYDEVAATPHDQLG-LVTREPVGVVGAIVPWNFPLMMACWKLGPALSTGNSVILKPSE 194 K Y D+ G + +E +GV G I PWNFP K+ A++ G+ V+LKP+E Sbjct: 119 -KSY----TFTEDRGGHTIIKEAIGVSGLITPWNFPTNQTSLKIAGAIAAGSPVVLKPAE 173 Query: 195 KSPLTAIRIAALAVEAGIPKGVFNVLPGYGHTVGNALALHMDVDTLVFTGSTKIAKQLLI 254 +P A+ +A + EAG+PKGVFN++ G G +G+ ++ H D+D + FTGS + +++ Sbjct: 174 ITPFAAMILAEIIDEAGVPKGVFNLVNGTGDVIGDGISSHPDIDFVSFTGSGAVGSKIM- 232 Query: 255 RSGESNMKRVWLEAGGKSPNIVFADAPDLQAAAESAAGAIAFNQGEVCTAGSRLLVERSI 314 + N+K+V LE GGKSP IV DA D+ AAE+A IA N G+VC+A +R+L+ S+ Sbjct: 233 ENAADNVKKVALELGGKSPLIVLDDA-DVDEAAETAIHHIAMNTGQVCSAATRVLIPESM 291 Query: 315 KDKFLPLVIEALKGWKPGNPL-DPATNVGALVDTQQMNTVLSYIEAGHADGAKLVAGGKR 373 KDKF ++ AL + G+P D AT G LV +Q +TV SYIE G +GA L+AGG Sbjct: 292 KDKFEKALLNALPKFTVGDPREDHAT--GPLVSKKQWDTVQSYIEKGIEEGATLLAGG-- 347 Query: 374 TLEETG---GTYVEPTIFDGVTNAMKIAKEEIFGPVLSVITFDSAEEAVAIANDTIYGLA 430 T + G G + + TIF V N M IA+EEIFGPV+SVIT+ + A+ IANDT+YGLA Sbjct: 348 TGKPDGIDKGYFAKHTIFTNVKNDMTIAQEEIFGPVMSVITYQDLDHALEIANDTVYGLA 407 Query: 431 AAVWTADISKAHLTAKALRAGSVWVNQYDGGDMTAPFGGFKQSGNGRDKSLHAFDKYTEL 490 V D A+ +RAG + +N + D APFGGFKQSG GR+ ++Y E+ Sbjct: 408 GYVVGQDEKTLKYVAEHIRAGQITINNAE-TDYFAPFGGFKQSGIGREWGDFGIEEYLEV 466 Query: 491 KA 492 KA Sbjct: 467 KA 468 Lambda K H 0.316 0.132 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 498 Number of extensions: 25 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 497 Length of database: 475 Length adjustment: 34 Effective length of query: 463 Effective length of database: 441 Effective search space: 204183 Effective search space used: 204183 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory