Align Asparagine permease (AnsP) of 497 aas and 12 TMSs (characterized)
to candidate WP_035702983.1 BA79_RS12105 amino acid permease
Query= TCDB::P40812 (497 letters) >NCBI__GCF_000691145.1:WP_035702983.1 Length = 462 Score = 340 bits (872), Expect = 6e-98 Identities = 176/448 (39%), Positives = 269/448 (60%), Gaps = 10/448 (2%) Query: 28 KAMGNRQVQMIAIGGAIGTGLFLGAGARLQMAGPALALVYLICGIFSFFILRALGELVLH 87 + + R +QMIA+GG IG GLF+G+ +Q GP++ L Y +CGIF FFI+RA+GE++ Sbjct: 8 RGLSARHIQMIALGGTIGVGLFMGSAKAIQWTGPSVLLAYAVCGIFIFFIMRAMGEMLYL 67 Query: 88 RPSSGSFVSYAREFLGEKAAYVAGWMYFINWAMTGIVDITAVALYMHYWGAFGDVPQWVF 147 PS+GSF ++ +++ A Y+ W + W + G+ +I AV YM YW F ++P W+ Sbjct: 68 EPSTGSFATFGHQYIHPLAGYMTAWSNWFQWVIVGMSEIIAVGAYMKYW--FPELPAWIP 125 Query: 148 ALGALTIVGTMNMIGVKWFAEMEFWFALIKVLAIVIFLV--VGTIFLGTGQPLEGNATGF 205 L A+ I+G N+I VK F E EFWFA+IK++ I++ ++ +G IF G G G A G Sbjct: 126 GLIAMIILGAANLISVKSFGEFEFWFAMIKIVTIILMIIAGLGIIFFGFGN--GGTAIGL 183 Query: 206 HLITDNGGFFPHGLLPALVLIQGVVFAFASIELVGTAAGECKDPQKMVPKAINSVIWRIG 265 + +GGFF G L + V+ A+ +EL+G AGE ++PQK + AI S+IWRI Sbjct: 184 SNLWAHGGFFTGGFSGFLFALSLVIAAYQGVELIGITAGEAQNPQKTLTNAIKSIIWRIL 243 Query: 266 LFYVGSVVLLVLLLPWNAYQAGQSPFVTFFSKLGVPYIGSIMNIVVLTAALSSLNSGLYC 325 +FY+G++ ++V + PW+ SPFV F+K+G+ I+N VV+TAA+S NSG++ Sbjct: 244 IFYIGAIFVIVTVYPWDQLNTLGSPFVATFAKIGITAAAGIINFVVITAAMSGCNSGIFS 303 Query: 326 TGRILRSMSMGGSAPKFMAKMSRQHVPYAGILATLVVYVVGVFLNYLVPSRVFEIVLNFA 385 GR+L ++ + G AP F K+S+ VPY G A L+ VGV LNY+ P +F V + + Sbjct: 304 AGRMLYTLGVNGQAPAFFTKISKNGVPYFGTFAVLIGLAVGVVLNYVSPPNIFVYVYSAS 363 Query: 386 SLGIIASWAFIMVCQMRLRQAIKEGKAADV-SFKLPGAPFTSWLTLLFLLSVLVLMAFDY 444 L + W I++ + R+A +G A D FK+P AP +++LT+ FLL VLV M + Sbjct: 364 VLPGMVPWFVILISHIGFRKA--KGAALDQHPFKMPLAPVSNYLTIGFLLMVLVFMLINQ 421 Query: 445 PNGTYTIASLP-LIAILLVAGWFGVRRR 471 I + LI + L FG+ +R Sbjct: 422 DTRISLIVGIVFLIVVALSFFIFGIGKR 449 Lambda K H 0.328 0.140 0.434 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 721 Number of extensions: 47 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 497 Length of database: 462 Length adjustment: 34 Effective length of query: 463 Effective length of database: 428 Effective search space: 198164 Effective search space used: 198164 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory