Align Glutamate/aspartate import permease protein GltK (characterized)
to candidate WP_024718895.1 BA79_RS11150 amino acid ABC transporter permease
Query= SwissProt::P0AER5 (224 letters) >NCBI__GCF_000691145.1:WP_024718895.1 Length = 219 Score = 151 bits (381), Expect = 1e-41 Identities = 79/218 (36%), Positives = 133/218 (61%), Gaps = 7/218 (3%) Query: 5 DWSSIVPSLPYLLDGLVITLKITVTAVVIGILWGTMLAVMRLSSFAPVAWFAKAYVNVFR 64 D+ ++P +P++L+GL +TL I V ++ +G + G +L + ++S F P+ W A Y ++FR Sbjct: 4 DFKDVIPQMPFILEGLKVTLSIVVVSLFLGFILGILLTLCKISVFKPLIWLADFYTSIFR 63 Query: 65 SIPLVMVLLWFYLIVPGFLQNVLGLSPKNDIRLISAMVAFSMFEAAYYSEIIRAGIQSIS 124 PLV+ LL Y +P L + + +A+ AFS+ AAY SEIIRAGI +I Sbjct: 64 GTPLVLQLLIIYFGLPQLLGFQID-------QYWAAVAAFSLNSAAYVSEIIRAGINAID 116 Query: 125 RGQSSAALALGMTHWQSMKLIILPQAFRAMVPLLLTQGIVLFQDTSLVYVLSLADFFRTA 184 +GQ AA+ALG+ + + MK ++LPQAF+ + P L+ + I L +++++V V+ L D R A Sbjct: 117 KGQKEAAVALGIPYAKMMKDLLLPQAFKNISPALVNETITLTKESAIVTVIGLGDVMRRA 176 Query: 185 STIGERDGTQVEMILFAGFVYFVISLSASLLVSYLKRR 222 G +E ++FAG +Y+VI L + + ++R+ Sbjct: 177 YQAGAVTYNYLEPLIFAGLIYYVIVLILTFVGKSVERK 214 Lambda K H 0.330 0.140 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 154 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 224 Length of database: 219 Length adjustment: 22 Effective length of query: 202 Effective length of database: 197 Effective search space: 39794 Effective search space used: 39794 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 45 (21.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory