Align Probable ATP-binding component of ABC transporter, component of Amino acid transporter, PA5152-PA5155. Probably transports numerous amino acids including lysine, arginine, histidine, D-alanine and D-valine (Johnson et al. 2008). Regulated by ArgR (characterized)
to candidate WP_035702289.1 BA79_RS08720 amino acid ABC transporter ATP-binding protein
Query= TCDB::Q9HU32 (257 letters) >NCBI__GCF_000691145.1:WP_035702289.1 Length = 246 Score = 265 bits (677), Expect = 7e-76 Identities = 130/255 (50%), Positives = 184/255 (72%), Gaps = 11/255 (4%) Query: 1 MAEATPALEIRNLHKRYGDLEVLKGISLTARDGDVISILGSSGSGKSTFLRCINLLENPH 60 M E+ + + L+K +G+L VLK I LT + DV+ ++G+SGSGKST LRC+N LE + Sbjct: 1 MTESKEIIRVEKLNKYFGELHVLKDIDLTVYENDVVVLIGASGSGKSTLLRCMNFLEIKN 60 Query: 61 QGQILVSGEELRLKKSKNGDLVAADSQQINRLRSELGFVFQNFNLWPHMSILDNVIEAPR 120 GQI++ G + K+ Q+N++R ++G VFQ+FNL+PH ++L+N+IEAP Sbjct: 61 DGQIIIDGSPVHPKRD-----------QLNKMRQKIGMVFQHFNLFPHKTVLENIIEAPV 109 Query: 121 RVLGKSKAEAIEIAEGLLAKVGIADKRHSYPAQLSGGQQQRAAIARTLAMQPKVILFDEP 180 V KA+AI A LL KVG+ADK YP++LSGGQ+QR AIAR LAM+P V+LFDEP Sbjct: 110 MVKKTKKAQAITEANVLLEKVGLADKAKVYPSKLSGGQKQRVAIARALAMKPDVMLFDEP 169 Query: 181 TSALDPEMVQEVLNVIRALAEEGRTMLLVTHEMSFARQVSSEVVFLHQGLVEEQGTPQQV 240 TSALDPE+V EVL +++LA+EG TM++VTHEM FA++V+ VV++H+G + EQGTP ++ Sbjct: 170 TSALDPELVGEVLQTMKSLAKEGMTMVIVTHEMGFAKEVADRVVYMHEGRIVEQGTPSEL 229 Query: 241 FENPQSARCKQFMSS 255 F++PQ R K F+SS Sbjct: 230 FDSPQEERTKLFLSS 244 Lambda K H 0.317 0.133 0.367 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 170 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 257 Length of database: 246 Length adjustment: 24 Effective length of query: 233 Effective length of database: 222 Effective search space: 51726 Effective search space used: 51726 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory