Align citrate synthase (unknown stereospecificity) (EC 2.3.3.16) (characterized)
to candidate WP_019743303.1 BA79_RS13130 citrate synthase
Query= BRENDA::P45858 (372 letters) >NCBI__GCF_000691145.1:WP_019743303.1 Length = 380 Score = 454 bits (1169), Expect = e-132 Identities = 219/367 (59%), Positives = 286/367 (77%) Query: 1 MEEKQHYSPGLDGVIAAETHISYLDTQSSQILIRGYDLIELSETKSYLELVHLLLEGRLP 60 M E+ Y PGL+ ++A+ET IS+LD Q +I+IRGYDLIEL+++K+YLE +LL+ GRLP Sbjct: 1 MTEQLQYKPGLEDIVASETSISFLDVQQEEIVIRGYDLIELAQSKTYLETAYLLIYGRLP 60 Query: 61 EESEMETLERKINSASSLPADHLRLLELLPEDTHPMDGLRTGLSALAGYDRQIDDRSPSA 120 + E ++ I+S +SL +L LP+ THPMD +RT LSALAGYD Q++DRS + Sbjct: 61 DAMEYHQFQQDISSQTSLHPTIQTILTKLPKTTHPMDAMRTCLSALAGYDEQLNDRSEAC 120 Query: 121 NKERAYQLLGKMPALTAASYRIINKKEPILPLQTLSYSANFLYMMTGKLPSSLEEQIFDR 180 + RA +LLG++PA+ A SY I+ + P QT SY+ NFL M+TG+ P+ E + FD+ Sbjct: 121 QQARAVRLLGQLPAIVAGSYHILTQDTTPTPDQTKSYTENFLAMLTGRTPAQDEIKAFDQ 180 Query: 181 SLVLYSEHEMPNSTFAARVIASTHSDLYGALTGAVASLKGNLHGGANEAVMYLLLEAKTT 240 +L LYSEHE+PNSTFAARVIASTHSD+YGA TGA++SLKG+LHGGANEAVM++LLE KTT Sbjct: 181 TLTLYSEHELPNSTFAARVIASTHSDMYGAFTGAISSLKGDLHGGANEAVMHMLLEGKTT 240 Query: 241 SDFEQLLQTKLKRKEKIMGFGHRVYMKKMDPRALMMKEALQQLCDKAGDHRLYEMCEAGE 300 F L++ KL KEK+MGFGHRVYM+KMDPRA ++K +L+ L + GD LY+MC AGE Sbjct: 241 EGFLALIERKLAAKEKMMGFGHRVYMRKMDPRAALLKRSLKTLTESKGDTTLYDMCVAGE 300 Query: 301 RLMEKEKGLYPNLDYYAAPVYWMLGIPIPLYTPIFFSARTSGLCAHVIEQHANNRLFRPR 360 M+++K LYPNLDYYAAP+Y++LGIPI LYTPIFF+AR SGL AHVIEQH++NR+FRPR Sbjct: 301 AYMKEKKNLYPNLDYYAAPIYYVLGIPISLYTPIFFAARASGLAAHVIEQHSHNRIFRPR 360 Query: 361 VSYMGPR 367 V Y+GPR Sbjct: 361 VRYLGPR 367 Lambda K H 0.317 0.134 0.381 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 436 Number of extensions: 14 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 372 Length of database: 380 Length adjustment: 30 Effective length of query: 342 Effective length of database: 350 Effective search space: 119700 Effective search space used: 119700 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory