Align BadI (characterized)
to candidate WP_008342913.1 BA79_RS08330 1,4-dihydroxy-2-naphthoyl-CoA synthase
Query= metacyc::MONOMER-892 (260 letters) >NCBI__GCF_000691145.1:WP_008342913.1 Length = 272 Score = 265 bits (677), Expect = 7e-76 Identities = 136/259 (52%), Positives = 177/259 (68%), Gaps = 2/259 (0%) Query: 2 QFEDLIYEIRNGVAWIIINRPDKMNAFRGTTCDELIKALYKAGYDKDVGAIVLAGAGDRA 61 Q+++++YE NG+A I INRP NAF T ELI A +A + DVG IVLAGAG +A Sbjct: 10 QYDEILYETYNGIAKITINRPHVHNAFTPKTVSELIDAFSRARDNSDVGVIVLAGAGGKA 69 Query: 62 FCTGGDQSTHD-GNYDGRGTVG-LPMEELHTAIRDVPKPVIARVQGYAIGGGNVLATICD 119 FC+GGDQ G Y G + L + +L IR +PKPVIA V GYAIGGG+VL +CD Sbjct: 70 FCSGGDQKVRGHGGYVGDDQIPRLNVLDLQRLIRVIPKPVIAMVAGYAIGGGHVLHVVCD 129 Query: 120 LTICSEKAIFGQVGPKMGSVDPGYGTAFLARVVGEKKAREIWYMCKRYSGKEAEAMGLAN 179 LTI ++ AIFGQ GPK+GS D GYG+ +LAR+VG KKAREIWY+C++Y+ +EA MGL N Sbjct: 130 LTIAADNAIFGQTGPKVGSFDAGYGSGYLARIVGHKKAREIWYLCRQYNAQEALDMGLVN 189 Query: 180 LCVPHDELDAEVQKWGEELCERSPTALAIAKRSFNMDTAHQAGIAGMGMYALKLYYDTDE 239 VP ++L+ E KW E++ E+SPTAL K +FN DT AGI A LYY TDE Sbjct: 190 TVVPLEQLEEETVKWCEDMLEKSPTALRFLKAAFNADTDGLAGIQQFAGDATLLYYTTDE 249 Query: 240 SREGVKALQEKRKPEFRKY 258 ++EG + +EKRKP+F ++ Sbjct: 250 AKEGRDSFKEKRKPDFGQF 268 Lambda K H 0.319 0.138 0.418 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 258 Number of extensions: 16 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 272 Length adjustment: 25 Effective length of query: 235 Effective length of database: 247 Effective search space: 58045 Effective search space used: 58045 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory