Align 2,3-dehydroadipyl-CoA hydratase (EC 4.2.1.17) (characterized)
to candidate WP_035701941.1 BA79_RS07305 enoyl-CoA hydratase
Query= metacyc::MONOMER-15953 (257 letters) >NCBI__GCF_000691145.1:WP_035701941.1 Length = 259 Score = 164 bits (416), Expect = 1e-45 Identities = 108/260 (41%), Positives = 148/260 (56%), Gaps = 6/260 (2%) Query: 1 MPHTLSVDAPEQGVRLITLQRPEALNALNTQLLDELAAELALAEQDAETRAVVLTGSRKA 60 M LS+ EQ LIT+Q P A NAL++QLL EL EQ++E RA+V+ G + Sbjct: 1 MEKILSLHQDEQ-TALITIQHPPA-NALSSQLLTELNDMFDQLEQNSEVRAIVIHGEGRF 58 Query: 61 FAAGADIKE---MAERDLVGILEDPRVAHWQRIAAFSKPLIAAVNGFCLGGGCELAMHAD 117 F+AGADIKE + E L D ++RI KP+IA+++G LGGG ELAM D Sbjct: 59 FSAGADIKEFTTLQEESDYASLADRGQQVFERIEQCPKPVIASIHGAALGGGLELAMSCD 118 Query: 118 ILIAGEDARFGQPEINLGIMPGAGGTQRLLRAVGKSLAMQMVLSGQAIDARHAQRAGLVS 177 I IA +DA+ G PE+NLGI+PG GGTQRL R VG + A++M+ + + I A GLVS Sbjct: 119 IRIATKDAKLGLPELNLGIIPGFGGTQRLPRYVGSAKALEMMGTAEPITGEEAFACGLVS 178 Query: 178 EVTLPE-LTIERALAIARVIAQKAPLAVRLAKEALLKAEDTDLASGLRFERHAFTVLAGT 236 ++ E +E A +A A K+P + E L + G++ E F + + Sbjct: 179 KLAETEDEALETAKTLAAKFAAKSPKTLEYVLELLNATKVYSYDGGMKLEAKKFGEVFQS 238 Query: 237 ADRAEGIRAFQEKRRPEFTG 256 D EGI+AF EKR+P F G Sbjct: 239 NDAKEGIQAFIEKRKPNFKG 258 Lambda K H 0.320 0.134 0.374 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 148 Number of extensions: 6 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 257 Length of database: 259 Length adjustment: 24 Effective length of query: 233 Effective length of database: 235 Effective search space: 54755 Effective search space used: 54755 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory