Align ABC transporter ATP-binding protein (characterized, see rationale)
to candidate WP_017359222.1 BA79_RS05440 betaine/proline/choline family ABC transporter ATP-binding protein
Query= uniprot:A0A165KC78 (242 letters) >NCBI__GCF_000691145.1:WP_017359222.1 Length = 382 Score = 112 bits (281), Expect = 8e-30 Identities = 76/234 (32%), Positives = 125/234 (53%), Gaps = 16/234 (6%) Query: 9 LLQVKGLKVAY-GGIQAVKGVDFEVREGELVSLIGSNGAGKTTTMKAITGTLSMNDGNIE 67 +L+++ + Y GG +AVK +D E+ +GE + IG +G GKTTTMK I + + GNI Sbjct: 1 MLKLENVSKTYKGGKKAVKNIDLEIAKGEFICFIGPSGCGKTTTMKMINRLIEPSSGNIL 60 Query: 68 YLGKSIKGKGAWDLVKEGLVMVPEGRGVFARMTITENLQMGAYI-------RKDKAGILA 120 G++I K L +E + V + G+F MTI +N+ + + RK++A Sbjct: 61 IEGENIMKKDPVQLRRE-IGYVIQQIGLFPHMTIAQNISLVPKLLKWPEEKRKERA---R 116 Query: 121 DIEKMFTIFPRLRERKDQLAGTMSGGEQQMLAMGRALMSQPKVLLLDEPSMGLSPIMVDK 180 ++ K+ + P ER +SGG+QQ + + RAL ++P ++L+DEP L PI D Sbjct: 117 ELLKLVDMGPEYLERYPH---ELSGGQQQRIGVLRALAAEPPLILMDEPFGALDPITRDS 173 Query: 181 IFEVVRDVY-ALGVTIVLVEQNASRALAIADRGYVMESGLITMTGPGQQLLNDP 233 + E + + L TIV V + A+ +ADR +++ G I G +L +P Sbjct: 174 LQEEFKKLQKTLNKTIVFVTHDMDEAIKLADRIVILKDGEIVQVGTPDDILRNP 227 Lambda K H 0.317 0.136 0.373 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 209 Number of extensions: 18 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 242 Length of database: 382 Length adjustment: 27 Effective length of query: 215 Effective length of database: 355 Effective search space: 76325 Effective search space used: 76325 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory