Align Acetyl-CoA acetyltransferase; Acetoacetyl-CoA thiolase; EC 2.3.1.9 (characterized)
to candidate WP_035702351.1 BA79_RS09045 acetyl-CoA C-acetyltransferase
Query= SwissProt::P45855 (393 letters) >NCBI__GCF_000691145.1:WP_035702351.1 Length = 391 Score = 459 bits (1180), Expect = e-134 Identities = 223/392 (56%), Positives = 298/392 (76%), Gaps = 2/392 (0%) Query: 1 MRKTVIVSAARTPFGKFGGVLKEVKAAELGGIVMKEALQQAGVSGDDVEGNVMGMVVQAG 60 M TVIVS ARTPFGK GG L + AAELGG+ +K AL++A + +V+ +MG V+Q G Sbjct: 1 MSTTVIVSGARTPFGKLGGTLSRLTAAELGGMTIKAALERAS-NVHEVDEVIMGSVLQGG 59 Query: 61 SGQIPSRQAARLAGMPWSVPSETLNKVCASGLRAVTLCDQMIRAQDADILVAGGMESMSN 120 GQIPSRQAAR A +PWSVP++T+NKVCASG+R+VT DQ+IRA DA+++VAGGMESMS+ Sbjct: 60 QGQIPSRQAARHADLPWSVPTQTINKVCASGMRSVTTADQIIRAGDANVIVAGGMESMSH 119 Query: 121 IPYAVPAGRWGARMGDGELRDLMVYDGLTCAFDEVHMAVHGNTAAKEYAISRREQDEWAL 180 PY + RWG +MGDG ++D M+ DGLTC+F VHM +G+ AAKE I+R EQD WAL Sbjct: 120 APYLLKKARWGYKMGDGAVQDAMILDGLTCSFTGVHMGEYGSMAAKELDITREEQDLWAL 179 Query: 181 RSHARAAKAADEGKFQDEIVPVNWIGRKGKPNVVDKDEAIRRDTSLDQLAKLAPIYASDG 240 RSH RA +A G F++EI+PV +KG ++ +DEA RRDTS ++L+KL P++ G Sbjct: 180 RSHERAIEAQKSGFFKNEIIPVTVKNKKGD-QLISEDEAPRRDTSYERLSKLMPVFDQAG 238 Query: 241 SITAGNAPGVNDGAGAFVLMSEEKAAELGKRPLATILGFSTTGMPAHELAAAPGFAINKL 300 +ITAGNAPGVNDGA A +LM + A + G++PLA +LG + + A + P +AI K+ Sbjct: 239 TITAGNAPGVNDGASALLLMKDTYAMQQGEKPLAVVLGHAQVAVEAKDFPKTPAYAIEKV 298 Query: 301 LKKNGLTVQDIDLFEVNEAFASVVLTCEKIVGFDLEKVNVNGGAIALGHPIGASGARILM 360 LKK G V+DIDLFE+NEAF++V L CEKI+G D K+NVNGGA+A+GHPIGASG RI++ Sbjct: 299 LKKTGKRVEDIDLFEINEAFSAVALACEKILGLDRRKMNVNGGAVAIGHPIGASGTRIIL 358 Query: 361 TLVYELKRRGGGLGVAAICSGAAQGDAVLVQV 392 TL++ L++RGGG+G+AAICSG QGDA++++V Sbjct: 359 TLIHALRQRGGGIGIAAICSGGGQGDAIMIKV 390 Lambda K H 0.317 0.134 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 500 Number of extensions: 17 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 393 Length of database: 391 Length adjustment: 31 Effective length of query: 362 Effective length of database: 360 Effective search space: 130320 Effective search space used: 130320 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory