Align Crotonyl-CoA hydratase; EC 4.2.1.150 (characterized)
to candidate WP_008342913.1 BA79_RS08330 1,4-dihydroxy-2-naphthoyl-CoA synthase
Query= SwissProt::Q0AVM1 (260 letters) >NCBI__GCF_000691145.1:WP_008342913.1 Length = 272 Score = 135 bits (340), Expect = 9e-37 Identities = 94/259 (36%), Positives = 132/259 (50%), Gaps = 8/259 (3%) Query: 3 YENIILEKEEKLAVLYINRPKAMNALNKDTLLEIKDAVTAVNDDPAVELLIITGSGDKSF 62 Y+ I+ E +A + INRP NA T+ E+ DA + D+ V ++++ G+G K+F Sbjct: 11 YDEILYETYNGIAKITINRPHVHNAFTPKTVSELIDAFSRARDNSDVGVIVLAGAGGKAF 70 Query: 63 VAGADIAFMQNLSAMEAREFGALGQ-KVFRLIEAMEKPVIAAVNGFALGGGCELAMCCDF 121 +G D + + + L + RLI + KPVIA V G+A+GGG L + CD Sbjct: 71 CSGGDQKVRGHGGYVGDDQIPRLNVLDLQRLIRVIPKPVIAMVAGYAIGGGHVLHVVCDL 130 Query: 122 RIAASNAKFGQPEVGLGITPGFGGTQRLPRLVGPGMAKQLLYTADVINADEAFRIGLVNK 181 IAA NA FGQ +G G+ L R+VG A+++ Y NA EA +GLVN Sbjct: 131 TIAADNAIFGQTGPKVGSFDAGYGSGYLARIVGHKKAREIWYLCRQYNAQEALDMGLVNT 190 Query: 182 VVQPEELLPEVKKIAGRILSKGQLAVRLSKAAANEGMQTDIDRAMSIE---ADAFGLCFA 238 VV E+L E K +L K A+R KAA N D D I+ DA L + Sbjct: 191 VVPLEQLEEETVKWCEDMLEKSPTALRFLKAAFN----ADTDGLAGIQQFAGDATLLYYT 246 Query: 239 TQDQKEGMTAFLEKRKANF 257 T + KEG +F EKRK +F Sbjct: 247 TDEAKEGRDSFKEKRKPDF 265 Lambda K H 0.319 0.136 0.378 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 177 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 272 Length adjustment: 25 Effective length of query: 235 Effective length of database: 247 Effective search space: 58045 Effective search space used: 58045 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory