Align 3-hydroxybutyryl-CoA dehydratase; EC 4.2.1.55 (characterized)
to candidate WP_035701941.1 BA79_RS07305 enoyl-CoA hydratase
Query= CharProtDB::CH_091794 (261 letters) >NCBI__GCF_000691145.1:WP_035701941.1 Length = 259 Score = 186 bits (473), Expect = 3e-52 Identities = 107/251 (42%), Positives = 156/251 (62%), Gaps = 8/251 (3%) Query: 8 LEKEGKVAVVTINRPKALNALNSDTLKEMDYVIGEIENDSEVLAVILTGAGEKSFVAGAD 67 L ++ + A++TI P A NAL+S L E++ + ++E +SEV A+++ G G + F AGAD Sbjct: 7 LHQDEQTALITIQHPPA-NALSSQLLTELNDMFDQLEQNSEVRAIVIHGEG-RFFSAGAD 64 Query: 68 ISEMKEMNTIEGRKFGIL---GNKVFRRLELLEKPVIAAVNGFALGGGCEIAMSCDIRIA 124 I E + E + L G +VF R+E KPVIA+++G ALGGG E+AMSCDIRIA Sbjct: 65 IKEFTTLQ--EESDYASLADRGQQVFERIEQCPKPVIASIHGAALGGGLELAMSCDIRIA 122 Query: 125 SSNARFGQPEVGLGITPGFGGTQRLSRLVGMGMAKQLIFTAQNIKADEALRIGLVNKVVE 184 + +A+ G PE+ LGI PGFGGTQRL R VG A +++ TA+ I +EA GLV+K+ E Sbjct: 123 TKDAKLGLPELNLGIIPGFGGTQRLPRYVGSAKALEMMGTAEPITGEEAFACGLVSKLAE 182 Query: 185 -PSELMNTAKEIANKIVSNAPVAVKLSKQAINRGMQCDIDTALAFESEAFGECFSTEDQK 243 E + TAK +A K + +P ++ + +N D + E++ FGE F + D K Sbjct: 183 TEDEALETAKTLAAKFAAKSPKTLEYVLELLNATKVYSYDGGMKLEAKKFGEVFQSNDAK 242 Query: 244 DAMTAFIEKRK 254 + + AFIEKRK Sbjct: 243 EGIQAFIEKRK 253 Lambda K H 0.317 0.134 0.365 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 186 Number of extensions: 7 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 261 Length of database: 259 Length adjustment: 24 Effective length of query: 237 Effective length of database: 235 Effective search space: 55695 Effective search space used: 55695 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory