Align D-lactate dehydrogenase (EC 1.1.1.28) (characterized)
to candidate WP_017367983.1 BA79_RS04725 D-glycerate dehydrogenase
Query= BRENDA::F8A9V0 (325 letters) >NCBI__GCF_000691145.1:WP_017367983.1 Length = 322 Score = 131 bits (330), Expect = 2e-35 Identities = 96/305 (31%), Positives = 156/305 (51%), Gaps = 24/305 (7%) Query: 24 WDVEMTPDFLDETTVEKAKGAQVVSLFVSDKADGPVLEALHSYGVGLLALRSAGYDHIDI 83 W E P +E + A+ ++++ +SD+ D +L ++ + ++A + GYD+ID+ Sbjct: 29 WTSEDEPCPREELEKQAAQADGLLTM-LSDQVDEALLS--NAPNLKVVANLAVGYDNIDL 85 Query: 84 ETAKRLGIKVVNVPAYSPHAIADHTLAIMLALIRRLHRAHDKVRLGDFDLDG---LMGFD 140 + AK+ GI V + P + AD A+++A RR+ A D ++ G++ G L G D Sbjct: 86 KAAKKHGITVCHTPDVLTESTADLAFALLMASARRIVEASDWIKDGNWTGWGPLLLAGAD 145 Query: 141 LNGKVAGVIGLGKIGRLVATRLKAFGCKVLGYDPYIQPEI-----VENVDLDTLITQADI 195 ++ K G++G+G IG +A R K F VL ++ +PE V D L+TQ+D Sbjct: 146 VHHKTLGIVGMGSIGTALAKRAKGFDMNVLYHNRSRKPEAEAQLGVTYAAFDELLTQSDF 205 Query: 196 ISIHCPLTRENFHMFNEETFKRMKPGAILVNTARGGLIDTKALLEALKSGKLGGAALDVY 255 I PLT E MFN++ F++MK A +N +RG +D AL +A+ +GK+ GA LDV+ Sbjct: 206 IVCLTPLTPETKEMFNKKAFEQMKNTAYFINVSRGQTVDEDALYDAVTTGKIAGAGLDVF 265 Query: 256 EYERGLFFKNHQKEGIKDPYLAQLLGLANVVLTGHQAFLTREAVKNIEETTVENILEWQK 315 KE + + L L NV + H + E KN+ ENI + Sbjct: 266 -----------SKEPVSPDH--PLTTLPNVTVLPHIGSASVETRKNMMHLCAENIALVLQ 312 Query: 316 NPQAK 320 + QAK Sbjct: 313 DQQAK 317 Lambda K H 0.321 0.140 0.407 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 238 Number of extensions: 13 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 325 Length of database: 322 Length adjustment: 28 Effective length of query: 297 Effective length of database: 294 Effective search space: 87318 Effective search space used: 87318 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory