Align D-serine/D-alanine/glycine transporter (characterized, see rationale)
to candidate WP_008347408.1 BA79_RS16380 amino acid permease
Query= uniprot:A0A0C4YRF7 (472 letters) >NCBI__GCF_000691145.1:WP_008347408.1 Length = 448 Score = 444 bits (1141), Expect = e-129 Identities = 217/448 (48%), Positives = 304/448 (67%), Gaps = 4/448 (0%) Query: 16 EKDLHRGLKDRHIQMIAIGGAIGVGLFLGAGRAIAIAGPGLMLSYAIGGVAIFFIMRALG 75 +++L R L +RH+Q+IAIGG IG GLFLG+G+AI +AGP ++ +Y I G+AIFF+MRALG Sbjct: 3 QQELKRDLSNRHVQLIAIGGTIGTGLFLGSGKAIQLAGPSIIFAYLIVGMAIFFVMRALG 62 Query: 76 ELLLYRPVSGSFATYAEEFVGPFAGFATGWSYWFMWVVTGMAEITAVAVYVHYWFPDVPQ 135 ELLL + S AE+++GP+A F TGW+YWF W++T MA++ AV VYV YWF D+PQ Sbjct: 63 ELLLSKAGYQSLTDIAEDYLGPWASFVTGWTYWFCWIMTAMADVIAVGVYVQYWF-DIPQ 121 Query: 136 WIPALATLAVLYLVNCVAVAVFGELEFWFALIKVVTIVAMIVIGLAIIFFGV-TPLGPTA 194 WIPA+ L +L N + V +FGE+EFWFALIKV+TI+ +I +G+ ++ G T GP Sbjct: 122 WIPAIICLLILLGFNLLTVKLFGEMEFWFALIKVITILLLIGVGIVLLIIGFQTDAGP-V 180 Query: 195 SFSNLWTHGGFMPFGTLGVVLTLQIVMFAYQGVELIGVTAGEAQNPEKVLPHATNGVVWR 254 + +NLW+HGG P G G +L+ Q+V+FAY GVEL+GV+A E NP+K +P A N + R Sbjct: 181 TVTNLWSHGGLFPNGVTGFLLSFQMVIFAYVGVELVGVSAAETANPQKNIPSAINKIPLR 240 Query: 255 ILIFYVGALIIMMALVPWNELKPGVSPFVYVFERIGVPGAAAIVNLVVITAAASSCNSGI 314 IL FYVGA+ +++ + PW EL SPFV F IG+P AA ++N VV+T+AAS+CNSG+ Sbjct: 241 ILFFYVGAIFVLLCINPWTELSASESPFVKTFGLIGIPVAAGLINFVVLTSAASACNSGM 300 Query: 315 FSTGRMLYTLAQFGQAPRAFGRVSSKHVPSIAITFSAALMGIGVLLNYIVPEQVFVWVTS 374 FST R+LY L+ Q P +FGR++ VPS A+ S ++ +G LL+ ++PEQ F VT+ Sbjct: 301 FSTSRILYNLSHQKQGPASFGRLNKHAVPSNALFVSTIVVSVGALLSKLIPEQAFGIVTT 360 Query: 375 ISLVGSLWTWSIIMIAHLGYRKAIAAGRVKAVAFRMPGAPYANWLVVAFMIAVAVLLSLD 434 IS + +W WSII+I HL Y+K KA F+ P P+ N V+ A+ V++ Sbjct: 361 ISAICFIWVWSIILICHLKYKKT-RPELHKASTFKAPFTPFVNIAVLVLFAAILVIMLFA 419 Query: 435 PGTRVALYVAPVWFALLGIGYRFTKSRA 462 TR AL + PVWF L + Y K R+ Sbjct: 420 DATRPALLLTPVWFGFLFLIYARKKRRS 447 Lambda K H 0.328 0.142 0.445 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 721 Number of extensions: 35 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 472 Length of database: 448 Length adjustment: 33 Effective length of query: 439 Effective length of database: 415 Effective search space: 182185 Effective search space used: 182185 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory