Align High-affinity branched-chain amino acid transport ATP-binding protein BraF, component of Branched chain amino acid uptake transporter. Transports alanine (characterized)
to candidate WP_017368436.1 BA79_RS17265 ABC transporter ATP-binding protein
Query= TCDB::P21629 (255 letters) >NCBI__GCF_000691145.1:WP_017368436.1 Length = 571 Score = 104 bits (259), Expect = 5e-27 Identities = 75/236 (31%), Positives = 122/236 (51%), Gaps = 19/236 (8%) Query: 21 VNGVNLKVEEKQVVSMIGPNGAGKTTVFNCLTGFYQPTGGLIRLDGEEIQG-LPGHKIAR 79 +N ++ V++ +++S+ G NGAGKTT+ L F +PT G I L+G++I G + R Sbjct: 319 LNNISFTVKKGEMISIAGANGAGKTTLSKVLCAFEKPTKGTIHLNGDDITGDTIKQRSER 378 Query: 80 KGVVRTFQNVRLFKEMTAVENLLVAQHRHLNTNFLAGLFKTPAFRRSEREAMEYAAHWLE 139 GVV N + K+M E L L G+ + R ER L+ Sbjct: 379 IGVVMQNPNQMISKQMIFDEVALGL--------VLRGVKEDDIKDRVERV--------LK 422 Query: 140 EVNLTEFANRSAGTLAYGQQRRLEIARCMMTRPRILMLDEPAAGLNPKETDDLKALIAKL 199 L F N L++GQ++R+ IA ++ P I++LDEP AG + + ++ + +L Sbjct: 423 VCGLYPFRNWPISALSFGQKKRVTIASILVLEPEIIILDEPTAGQDFRHYTEMMTFLEQL 482 Query: 200 RSEHNVTVLLIEHDMKLVMSISDHIVVINQGAPLADGTPEQI-RDNPDVIKAYLGE 254 ++ VT+L+I HDM L++ + +VI+ G +AD TP ++ D V KA L E Sbjct: 483 -NQQGVTILMITHDMHLMLEYTTRTIVISDGEKIADDTPAKVLTDQLLVQKASLKE 537 Score = 71.6 bits (174), Expect = 3e-17 Identities = 67/260 (25%), Positives = 122/260 (46%), Gaps = 19/260 (7%) Query: 1 MSRPILEVS--GLTMRFGGLLAVNGVNLKVEEKQVVSMIGPNGAGKTTVFNCLTGFYQPT 58 M +P+++ G R + VNL + E + V + GP+G+GK+T+ +C+ G P Sbjct: 1 MKKPMIQFEHFGFKYRSQAEPTLKDVNLTIYEGEKVLIAGPSGSGKSTLAHCINGLV-PA 59 Query: 59 GGLIRLDGEEIQGLPGHKIARKGVVRTFQNVRLFKEMTAVENLLVAQHRHLNTNFLAGLF 118 ++G G G ++ + Q V + + + + + + L Sbjct: 60 SYKGSMEGSLHIG--GKNAEKENIFSLSQLVGTVLQDPDGQFIGLT----VGEDIAFTLE 113 Query: 119 KTPAFRRSEREAMEYAAHWLEEVNLTEFANRSAGT---LAYGQQRRLEIARCMMTRPRIL 175 R + +E AA LTE + A + L+ GQ++R+ IA ++ IL Sbjct: 114 NDQVTREEMKTRVEKAA------KLTEVDGKLASSVHELSGGQKQRVAIAGVLVNDVDIL 167 Query: 176 MLDEPAAGLNPKETDDLKALIAKLRSEHNVTVLLIEHDMK-LVMSISDHIVVINQGAPLA 234 + DEP A L+P ++ LI +L+ E TV+++EH ++ ++ D I+V+N G A Sbjct: 168 LFDEPLASLDPATGKEVIDLIDRLQKETKKTVVMVEHRLEDVLFRHVDRIIVVNDGTIAA 227 Query: 235 DGTPEQIRDNPDVIKAYLGE 254 D TP+++ + + AYL E Sbjct: 228 DMTPDELLASNVLEAAYLRE 247 Lambda K H 0.320 0.137 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 359 Number of extensions: 19 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 3 Number of HSP's successfully gapped: 3 Length of query: 255 Length of database: 571 Length adjustment: 30 Effective length of query: 225 Effective length of database: 541 Effective search space: 121725 Effective search space used: 121725 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory