Align ABC transporter ATP-binding protein-branched chain amino acid transport, component of The branched chain hydrophobic amino acid transporter, LivJFGHM (characterized)
to candidate WP_025206726.1 BA79_RS12885 ABC transporter ATP-binding protein
Query= TCDB::Q8DQH8 (254 letters) >NCBI__GCF_000691145.1:WP_025206726.1 Length = 363 Score = 141 bits (355), Expect = 2e-38 Identities = 84/253 (33%), Positives = 139/253 (54%), Gaps = 20/253 (7%) Query: 1 MALLEVKQLTKHFGGLTAVGDVTLELNEGELVGLIGPNGAGKTTLFNLLTGVYEPSEGTV 60 M+ + ++ +++HFG A+ DV+L + EGE L+GP+G GK+TL N++ G EP++G V Sbjct: 1 MSGINLEHISQHFGEQIALDDVSLTVKEGEFFSLLGPSGCGKSTLLNIIGGFLEPTKGVV 60 Query: 61 TLDGHLLNGKSPYKIASLGLGRTFQNIRLFKDLTVLDNVLIAFGNHHKQHVFTSFLRLPA 120 + + PY+ + G FQ+ LF LTV DNV A+G L Sbjct: 61 YIGDQDVTTLPPYQRKT---GMVFQSYALFPHLTVFDNV--AYG-------------LKV 102 Query: 121 FYKSEKELKAKALELLKIFDLDGDAETLAKNLSYGQQRRLEIVRALATEPKILFLDEPAA 180 K + E+K K +E L + L+ A+ + LS GQQ+R+ I RALA +P +L LDEP + Sbjct: 103 QKKKKAEIKQKVMESLSLVQLESFAKRMPHQLSGGQQQRVAIARALAIQPAVLLLDEPLS 162 Query: 181 GMNPQETAELTELIRRIKDEFKITIMLIEHDMNLVMEVTERIYVLEYGRLIAQGTPDEI- 239 ++ + + +R I+ IT +L+ HD + +++RI +L G++ GTP E+ Sbjct: 163 NLDAKLRKNMQTELRNIQRNVGITTILVTHDQEEALSLSDRIGILGEGKIQQIGTPLEVY 222 Query: 240 -KTNKRVIEAYLG 251 + N R + ++G Sbjct: 223 RQPNNRFVAEFIG 235 Lambda K H 0.319 0.139 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 208 Number of extensions: 13 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 254 Length of database: 363 Length adjustment: 27 Effective length of query: 227 Effective length of database: 336 Effective search space: 76272 Effective search space used: 76272 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory