Align D-xylose reductase (EC 1.1.1.307) (characterized)
to candidate WP_035702093.1 BA79_RS08060 aldo/keto reductase
Query= BRENDA::A0MTG4 (323 letters) >NCBI__GCF_000691145.1:WP_035702093.1 Length = 279 Score = 184 bits (468), Expect = 2e-51 Identities = 116/309 (37%), Positives = 166/309 (53%), Gaps = 42/309 (13%) Query: 11 LNNGLEMPSIGFGCWKLGKSTAA-DQVYNAIKAGYRLFDGAEDYGNEQEVGEGVKRAIDE 69 LNNG+ MP G G +++ + T + V AI+ GYR D A YGNE+ VG G++ + E Sbjct: 10 LNNGVRMPGFGLGVFQVEEGTELIEAVKTAIQLGYRSIDTASIYGNEEGVGRGIQLGLAE 69 Query: 70 GIVTREEIFLTSKLWNNYHDPKNVETALNKTLKDLKVDYVDLFLIHFPIAFKFVPIEEKY 129 + RE+IF+TSK+WN + A +LK L++DY+DL+LIH+P+ E KY Sbjct: 70 TGLRREDIFVTSKVWNADLGYEATLKAYEDSLKKLQLDYLDLYLIHWPV-------EGKY 122 Query: 130 PPGFYCGDGDNFVYEDVPILETWKALEKLVKAGKIRSIGVSNFPGALLLDLFRGATIKPA 189 E W+ALE L + GK+R+IGVSNF L +L A I PA Sbjct: 123 K-------------------EAWRALETLYREGKVRAIGVSNFQPHHLDELLTDADIIPA 163 Query: 190 VLQVEHHPYLQQPKLIEYAQKVGITVTAYSSFGPQSFVEMNQGRALNTPTLFEHDVIKAI 249 + QVE HP L Q L Y + GI + A+S + QG L+ H +I + Sbjct: 164 INQVEFHPKLTQETLFTYLKTHGIQMEAWSP--------LMQGELLH------HPLITEL 209 Query: 250 AAKHNKVPAEVLLRWSAQRGIAVIPKSNLPERLVQNRSFNDFELTKEDFEEISKLDINLR 309 A ++K PA+++LRW Q+G+ IPKS RL +N DF L+ ED + +S L+ N R Sbjct: 210 AGTYSKTPAQIILRWDVQKGVITIPKSTKAHRLKENADIFDFVLSDEDMKRLSDLNENKR 269 Query: 310 FN-DPWDWD 317 DP ++D Sbjct: 270 IGPDPDNFD 278 Lambda K H 0.319 0.139 0.422 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 261 Number of extensions: 14 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 323 Length of database: 279 Length adjustment: 27 Effective length of query: 296 Effective length of database: 252 Effective search space: 74592 Effective search space used: 74592 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory