Align histidine transport ATP-binding protein hisP (characterized)
to candidate WP_027699581.1 TT13_RS08465 ABC transporter ATP-binding protein/permease
Query= CharProtDB::CH_003210 (257 letters) >NCBI__GCF_000691805.2:WP_027699581.1 Length = 651 Score = 152 bits (385), Expect = 1e-41 Identities = 86/230 (37%), Positives = 144/230 (62%), Gaps = 16/230 (6%) Query: 6 LNVIDLHKRY----GEHEVLKGVSLQANAGDVISIIGSSGSGKSTFLRCINFLEKPSEGS 61 L + D+ K Y E VLKG++L+ G+ +SI+G SG GKST + I L++ +G Sbjct: 4 LTLRDIQKSYFLGKEEFPVLKGINLEFELGEFVSILGESGGGKSTLMNIIGGLDREFDGE 63 Query: 62 IVVNGQTINLVRDKDGQLKVADKNQLRLLRTRLTMVFQHFNLWSHMTVLENVMEAPIQVL 121 + G ++ ++K ++ R R + ++Q +NL SH+TVL+NV+ + +++ Sbjct: 64 VTFEGTLLDHKKEKQ-------LDEYR--RGTIGYIYQAYNLISHLTVLDNVLVS-LEMT 113 Query: 122 GLSKQEARERAVKYLAKVGIDERAQGKYPVHLSGGQQQRVSIARALAMEPEVLLFDEPTS 181 LS++E RA + L +VG+ ++ + K+P LSGGQ+QRV+IARALA +P++++ DEPT Sbjct: 114 NLSQKERINRATELLERVGLGDQMK-KHPNQLSGGQKQRVAIARALAADPKIIIADEPTG 172 Query: 182 ALDPELVGEVLRIMQQLAEEGKTMVVVTHEMGFARHVSTHVIFLHQGKIE 231 ALD + EVL +++++A+EGK ++ VTH A H T ++ L GKI+ Sbjct: 173 ALDSQNTAEVLTLLEEIAKEGKLVIAVTHSQEVANH-GTRIVHLADGKID 221 Lambda K H 0.318 0.134 0.375 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 299 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 257 Length of database: 651 Length adjustment: 31 Effective length of query: 226 Effective length of database: 620 Effective search space: 140120 Effective search space used: 140120 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory