Align alcohol dehydrogenase (EC 1.1.1.1) (characterized)
to candidate WP_027699119.1 TT13_RS05830 glucose 1-dehydrogenase
Query= BRENDA::Q4J702 (264 letters) >NCBI__GCF_000691805.2:WP_027699119.1 Length = 270 Score = 132 bits (331), Expect = 1e-35 Identities = 76/246 (30%), Positives = 130/246 (52%), Gaps = 2/246 (0%) Query: 11 GMNAVVLGASSGIGKAIAEMFSEMGGKVVLSDI--DEEGLKRLSDSLRSRGHEVNHMKCD 68 G AVV G+SSGIG+AIA G VV++ D++ + + + G +K D Sbjct: 15 GKTAVVTGSSSGIGEAIARHMGAEGMNVVINYFSPDDKAIDGIIYLIEQSGGHAVAIKAD 74 Query: 69 ITDLNQVKKLVNFSLSVYGNVDALYVTPSINVRKSIENYTYEDFEKVINVNLKGNFMVVK 128 + V+ + + ++ +G++D ++ + Y D+++VI+V+L G F+ K Sbjct: 75 VGTEAGVQAIYDKAIEAFGDLDVWVNNAGFEIQSATHLTDYRDWQRVIHVDLDGVFLGTK 134 Query: 129 EFLSVMKNNKGGGSVVLFSSIRGTVVEPGQSVYAMTKAGIIQLAKVAAAEYGKYNIRVNV 188 ++ + G ++ SSI + P + YA KAG++ K +A EY IR+N Sbjct: 135 IAINHFLTHNKVGQILNTSSIHDKIPWPTYASYATAKAGVLMFTKTSALEYADKGIRINA 194 Query: 189 IAPGVVDTPLTRQIKSDPEWFKAYTEKTILKRWATPEEIANVALFLAMPASSYITGTVIY 248 I+PG ++TP+ + +DP K T+ +KR P ++AN A++L +SYITGT +Y Sbjct: 195 ISPGALETPINAERFADPAVRKDTTDMIPMKRIGDPLDVANAAVWLISSEASYITGTTLY 254 Query: 249 VDGGWT 254 +DGG T Sbjct: 255 IDGGIT 260 Lambda K H 0.317 0.134 0.381 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 189 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 264 Length of database: 270 Length adjustment: 25 Effective length of query: 239 Effective length of database: 245 Effective search space: 58555 Effective search space used: 58555 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory