Align alcohol dehydrogenase (EC 1.1.1.1) (characterized)
to candidate WP_027699596.1 TT13_RS08545 alcohol dehydrogenase AdhP
Query= BRENDA::Q9CEN0 (340 letters) >NCBI__GCF_000691805.2:WP_027699596.1 Length = 348 Score = 410 bits (1053), Expect = e-119 Identities = 210/349 (60%), Positives = 263/349 (75%), Gaps = 11/349 (3%) Query: 1 MKAAVVRHNPDGYADLVEK-ELRAIKPNEALLDMEYCGVCHTDLHVAAGDYGNKAGT--- 56 MKAAVVR N DGY DL++ E RA+ EAL+D+EY G+CHTDLHVA GD+G+ + Sbjct: 1 MKAAVVRENLDGYVDLIDNWEPRALSFGEALVDVEYSGLCHTDLHVAGGDFGDPSTINPR 60 Query: 57 ----VLGHEGIGIVKEIGTDVSS-LQVGDRVSVAWFFEGCGHCEYCVSGNETFCREVKNA 111 V+GHEG+G V ++ L++GDRVS+AWF++ CG+CEYC SGNETFCR+V+NA Sbjct: 61 PFRRVIGHEGVGRVTKLAEGADDYLKIGDRVSIAWFYDACGNCEYCNSGNETFCRKVRNA 120 Query: 112 GYSVDGGMAEEAIVVADYAVKVPDGLDPIEASSITCAGVTTYKAIKVSGVKPGDWQVIFG 171 G+SVDG MA++ +V A YAVKVP+GLDP+EASSITCAGVT YK++KV KPG W + G Sbjct: 121 GFSVDGAMAQQVVVNAKYAVKVPEGLDPMEASSITCAGVTMYKSLKVGETKPGQWVSVVG 180 Query: 172 AGGLGNLAIQYAKNVFGAKVIAVDINQDKLNLAKKIGADVIINSGDVNPVDEIKKITGGL 231 AGGLGNLA+QYA NVFGA V+AVD N DKL AK++GA+++IN + I++ GG+ Sbjct: 181 AGGLGNLAVQYAHNVFGAHVVAVDGNPDKLAAAKEMGAELLINRKTEDVPAVIQEKVGGV 240 Query: 232 GAQSAIVCAVARIAFEQAVASLKPMGKMVAVALPNTEMTLSVPTVVFDGVEVAGSLVGTR 291 +A V AV AF Q++ASL+PMGK+VAVALP+ +M L+V V DG+EV GSLVGTR Sbjct: 241 --HNAQVTAVNTTAFNQSIASLRPMGKLVAVALPSGDMGLNVVKTVLDGIEVRGSLVGTR 298 Query: 292 LDLAEAFQFGAEGKVKPIVATRKLEEINDIIDEMKAGKIEGRMVIDFTK 340 DL EAFQFGAEGKVKPIV + +IND+IDEMK GKI GRMV DFTK Sbjct: 299 EDLKEAFQFGAEGKVKPIVTRADIRDINDVIDEMKNGKITGRMVFDFTK 347 Lambda K H 0.318 0.136 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 452 Number of extensions: 16 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 340 Length of database: 348 Length adjustment: 29 Effective length of query: 311 Effective length of database: 319 Effective search space: 99209 Effective search space used: 99209 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory