Align ABC transporter for D-glucosamine, ATPase component (characterized)
to candidate WP_027699423.1 TT13_RS07590 amino acid ABC transporter ATP-binding protein
Query= reanno::pseudo3_N2E3:AO353_21725 (265 letters) >NCBI__GCF_000691805.2:WP_027699423.1 Length = 245 Score = 239 bits (609), Expect = 5e-68 Identities = 123/247 (49%), Positives = 167/247 (67%), Gaps = 10/247 (4%) Query: 14 ALLEIRDLHKQYGPLEVLKGVDLTMQRGNVVTLIGSSGSGKTTLLRCVNMLEEFQGGQIL 73 A++E+ ++HK +G EVLKG+DL ++ G +V +IG SGSGK+T LR +N LE GQI+ Sbjct: 3 AIVEVNNVHKSFGQNEVLKGIDLHVEEGELVVMIGPSGSGKSTFLRTLNQLETIDEGQII 62 Query: 74 LDGESIGYHEVNGKRVRHSEKVIAQHRAMTGMAFQQFNLFPHLTALQNVTLGLLKVKKLH 133 + G + + N + R + GM FQ FNLFPHLT ++N+ L +++ K Sbjct: 63 IAGRDLSDAKTNINKTREN----------IGMVFQHFNLFPHLTVIENMMLAPVELGKED 112 Query: 134 KDEAVVLAEKWLERVGLLERRDHYPGQLSGGQQQRVAIARAIAMNPSLMLFDEVTSALDP 193 K A A K L+RVGL ++ D P LSGGQ+QRVAIARA+ MNP +MLFDE TSALDP Sbjct: 113 KATAKETAYKLLDRVGLRDKADARPATLSGGQKQRVAIARALQMNPKIMLFDEPTSALDP 172 Query: 194 ELVGEVLSVIKGLAEDGMTMLLVTHEMRFAFEVSDKIVFMNQGRIEEQGPPKELFERPQS 253 E+VG+VL V+K L+ +GMTM++VTHEM FA +V+D++VF G I E G P E+F PQ Sbjct: 173 EMVGDVLDVMKQLSTEGMTMIVVTHEMGFARQVADRVVFFADGYIREAGKPDEIFGNPQD 232 Query: 254 PRLAEFL 260 PRL +FL Sbjct: 233 PRLQDFL 239 Lambda K H 0.319 0.135 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 182 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 265 Length of database: 245 Length adjustment: 24 Effective length of query: 241 Effective length of database: 221 Effective search space: 53261 Effective search space used: 53261 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory