Align PTS system mannose-specific EIID component; EII-M-Man; EIID-Man; Mannose permease IID component (characterized)
to candidate WP_045477156.1 TT13_RS09605 PTS mannose/fructose/sorbose transporter family subunit IID
Query= SwissProt::P69805 (283 letters) >NCBI__GCF_000691805.2:WP_045477156.1 Length = 324 Score = 277 bits (709), Expect = 2e-79 Identities = 144/322 (44%), Positives = 208/322 (64%), Gaps = 45/322 (13%) Query: 5 TQTTTEKKLTQSDIRGVFLRSNLFQGSWNFERMQALGFCFSMVPAIRRLYPENNEARKQA 64 T TT + L++ V + S QGSWN+ERMQ +G+ FS++PA++RLY E K A Sbjct: 3 TNTTKKVTLSKGTRFKVMMSSMFIQGSWNYERMQNVGWAFSLMPALKRLYKPGTEEAKLA 62 Query: 65 IRRHLEFFNTQPFVAAPILGVTLALEEQRANGAEIDDGAINGIKVGLMGPLAGVGDPIFW 124 ++RH+EFFNT P++A+PILGVTLALEE+RANGA+ID+ AI G+KVG+MGPLAG+GDP+FW Sbjct: 63 LQRHMEFFNTHPYLASPILGVTLALEEERANGAKIDNAAIQGVKVGMMGPLAGIGDPVFW 122 Query: 125 GTVRPVFAALGAGIAMSGSLLGPLLFFILFNLVRLATRYYGVAYGYSKGIDIVKDMGGGF 184 TVRP+ A+ A +A+SGS++ P++FF+ +N++R+A +Y +GY +G I D+GGG Sbjct: 123 FTVRPIIGAIAASLAVSGSIIAPIVFFVAWNIIRIAFLWYTQEFGYKQGTAITGDLGGGM 182 Query: 185 LQKLTEGASILGLFVMGALVNKWTHVN----------IPL-----------------VVS 217 LQK+T+GASILG+FV+GAL+ +W ++ +PL + + Sbjct: 183 LQKVTKGASILGMFVLGALIQRWVSISWTGPNSVVSKLPLSKGAYLDWNSLPSGAQGIKT 242 Query: 218 RIT-----DQTGK----------EHVTTVQTILDQLMPGLVPLLLTFACMWLLRK---KV 259 IT D +G +T +Q L+ L+PGL LLLTF +WLLRK + Sbjct: 243 AITTLFKQDASGNLTQSGVYMTPNKITYLQDNLNMLLPGLSALLLTFLVIWLLRKFKSRN 302 Query: 260 NPLWIIVGFFVIGIAGYACGLL 281 PL+II+G F+ GI + GL+ Sbjct: 303 TPLYIIIGLFIFGILLHWAGLM 324 Lambda K H 0.326 0.143 0.439 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 279 Number of extensions: 16 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 283 Length of database: 324 Length adjustment: 27 Effective length of query: 256 Effective length of database: 297 Effective search space: 76032 Effective search space used: 76032 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory