Align PotG aka B0855, component of Putrescine porter (characterized)
to candidate WP_027698251.1 TT13_RS01035 amino acid ABC transporter ATP-binding protein
Query= TCDB::P31134 (377 letters) >NCBI__GCF_000691805.2:WP_027698251.1 Length = 246 Score = 142 bits (359), Expect = 7e-39 Identities = 86/235 (36%), Positives = 134/235 (57%), Gaps = 10/235 (4%) Query: 19 LLEIRNLTKSYDGQHAVDDVSLTIYKGEIFALLGASGCGKSTLLRMLAGFEQPSAGQIML 78 +L++ N+ K Y A++++++T + ++G SG GKSTLLR L EQP +G L Sbjct: 1 MLKLENINKQYVEHRALENINVTFQSDQTTVIVGPSGSGKSTLLRSLNLLEQPDSGIYTL 60 Query: 79 DG--VDLSQVPPYL------RPINMMFQSYALFPHMTVEQNIAFG-LKQDKLPKAEIASR 129 D +D SQ R M+FQ +F H++V +NI ++ K PKA + Sbjct: 61 DNQVIDFSQPITTQTLLWTRRQTGMVFQQPRMFDHLSVLKNITEAPIQVLKEPKATAQAE 120 Query: 130 VNEMLGLVHMQEFAKRKPHQLSGGQRQRVALARSLAKRPKLLLLDEPMGALDKKLRDRMQ 189 ++L V + + A R P+QLSGGQ QRVA+AR+LA +PK LLLDEP ALD +L ++ Sbjct: 121 ALKLLAAVGLADTANRYPYQLSGGQTQRVAIARALAMKPKYLLLDEPTSALDPELEAQI- 179 Query: 190 LEVVDILERVGVTCVMVTHDQEEAMTMAGRIAIMNRGKFVQIGEPEEIYEHPTTR 244 L +++ + + T ++VTH+ + A A RI + G+ G P + ++HPT R Sbjct: 180 LHILNQIAKTDQTMIIVTHNMDFARAAADRILFLEDGQIQFDGTPTDFFDHPTAR 234 Lambda K H 0.321 0.137 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 210 Number of extensions: 13 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 377 Length of database: 246 Length adjustment: 27 Effective length of query: 350 Effective length of database: 219 Effective search space: 76650 Effective search space used: 76650 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory