Align iron(III) dicitrate transport system permease protein FecD (characterized)
to candidate WP_031499433.1 M017_RS0117505 iron ABC transporter permease
Query= CharProtDB::CH_004160 (318 letters) >NCBI__GCF_000702445.1:WP_031499433.1 Length = 326 Score = 164 bits (415), Expect = 3e-45 Identities = 110/324 (33%), Positives = 175/324 (54%), Gaps = 22/324 (6%) Query: 4 ALVIFITLALAGCALLSL--HMGVIPVPWRALLTDWQAGHEHYYVLMEYRLPRLLLALFV 61 A+ + ALA A L++ +G + + L W+ + + + RLPR +LAL Sbjct: 9 AITTLLVSALAALAALAICPFLGGSGMDYGKL---WRQESPDWAIFLNLRLPRAILALLS 65 Query: 62 GAALAVAGVLIQGIVRNPLASPDILGVNHAASLASVGALLLMP----SLPVMVLPLLAFA 117 G ALA +G + Q ++R+ LA+PD LGV AASL +V ++ L+ S PV+ L +A A Sbjct: 66 GGALASSGAMFQALLRDALATPDNLGVTAAASLGAVLSISLLDGAETSFPVVWLAAVAGA 125 Query: 118 GGMAGLILLKMLAKTHQPMKLALTGVALSACWASLTDYLM----LSRPQDVNNALLWLTG 173 G +A LI + PM L LTG+A++A A++ L ++R + + WL G Sbjct: 126 GLVALLISALAATRKFSPMSLLLTGIAVNAMCAAVIMLLHSLAGITRSFQITH---WLMG 182 Query: 174 SLWGRDWSFVKIAIPLMILFLPLS---LSFCRDLDLLALGDARATTLGVSVPHTRFWALL 230 + +S + I L ++ PL L R L++++ G+ A G+ + L Sbjct: 183 GIDAVPYSTLAI---LALILTPLCFWVLLQARVLNVISFGETWAMGRGIDARKKTWQGFL 239 Query: 231 LAVAMTSTGVAACGPISFIGLVVPHMMRSITGGRHRRLLPVSALTGALLLVVADLLARII 290 + + T A GPI+F+GL+VPH++R + G +R LLP S G L++ D +AR + Sbjct: 240 VGTLLVGTTTAITGPIAFVGLIVPHLLRRMVGPDYRVLLPASLFGGGAFLILCDTIARTV 299 Query: 291 HPPLELPVGVLTAIIGAPWFVWLL 314 P E+PVGV+TA++G P+FVWLL Sbjct: 300 LAPAEIPVGVITALLGGPFFVWLL 323 Lambda K H 0.330 0.142 0.447 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 288 Number of extensions: 13 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 318 Length of database: 326 Length adjustment: 28 Effective length of query: 290 Effective length of database: 298 Effective search space: 86420 Effective search space used: 86420 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory