Align butanoyl-CoA dehydrogenase (NAD+, ferredoxin) (subunit 1/3) (EC 1.3.1.109) (characterized)
to candidate WP_038067173.1 DL1_RS13395 electron transfer flavoprotein subunit alpha/FixB family protein
Query= BRENDA::Q18AQ5 (336 letters) >NCBI__GCF_000715505.1:WP_038067173.1 Length = 308 Score = 155 bits (393), Expect = 9e-43 Identities = 107/308 (34%), Positives = 168/308 (54%), Gaps = 14/308 (4%) Query: 18 VSLELLGKATEIAKDYDTKVSALLLGSKVEGLIDTLAHY-GADEVIVVDDEALAVYTTEP 76 +SL+ KA AK V+ L G+ + + G +V+V +D +L EP Sbjct: 14 LSLDATAKAVSAAKSLGD-VTVLCAGASAAAAGEAASKIDGVAKVLVAEDASLGHRLAEP 72 Query: 77 YTKAAYEAIKAADPIVVLFGATSIGRDLAPRVSARIHTGLTADCTGLAVAEDTKLLLMTR 136 AA A D ++ AT+ +++ PRV+A + + +D +G+ A+ + R Sbjct: 73 --TAALIVSLAGDYSHIVAPATTDAKNVMPRVAALLDVMILSDVSGVVDADTFE-----R 125 Query: 137 PAFGGNIMATIVCKDFRPQMSTVRPGVMKKNEPDETKEAVINRFKVEFNDADKLVQVVQV 196 P + GN + T+ KD + ++ T R + + A + V +A L V+ Sbjct: 126 PIYAGNAIQTVKSKDEK-KVITFRTSTF--DAAGDGGAASVET--VGAAEAAGLSSWVED 180 Query: 197 IKEAKKQVKIEDAKILVSAGRGMGGKENLDILYELAEIIGGEVSGSRATIDAGWLDKARQ 256 + ++ AKI+VS GRG+G +++ ++ LA+ +G V SRA +D+G+ Q Sbjct: 181 KVAESDRPELTSAKIVVSGGRGVGSEDDFKVIEALADKLGAAVGASRAAVDSGFAPNDWQ 240 Query: 257 VGQTGKTVRPDLYIACGISGAIQHIAGMEDAEFIVAINKNPEAPIFKYADVGIVGDVHKV 316 VGQTGK V P+LYIACGISGAIQH+AGM+D++ IVAINK+ EAPIF+ AD G+V D+ Sbjct: 241 VGQTGKVVAPELYIACGISGAIQHLAGMKDSKVIVAINKDEEAPIFQVADFGLVADLFDA 300 Query: 317 LPELISQL 324 +PEL +L Sbjct: 301 VPELTEKL 308 Lambda K H 0.316 0.135 0.371 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 264 Number of extensions: 13 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 336 Length of database: 308 Length adjustment: 28 Effective length of query: 308 Effective length of database: 280 Effective search space: 86240 Effective search space used: 86240 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory