Align lactate dehydrogenase (NAD+, ferredoxin) (subunit 1/3) (EC 1.3.1.110) (characterized)
to candidate WP_043770000.1 U743_RS16750 FAD-binding protein
Query= BRENDA::H6LBS1 (466 letters) >NCBI__GCF_000733765.1:WP_043770000.1 Length = 453 Score = 219 bits (559), Expect = 1e-61 Identities = 159/454 (35%), Positives = 225/454 (49%), Gaps = 11/454 (2%) Query: 12 AAIKELIPAERVFVGTEIGEDFSHDELGSIHSYPEV-LIKVTSTEEVSKIMKYAYEHNIP 70 A + E +PA + +I + D+ G + V L++ S + V ++ A P Sbjct: 6 ARLAEAVPAAELSTDADIIRAHARDQAGLCDAGAAVALVRARSVDTVIATLRVATATRTP 65 Query: 71 VVVRGSGTGLVGACVPLFGGIMLETTLMNNILELDTENLTVTVEPGVLLMELSKFVEEND 130 VV RG+GTGL G G I+L ++ ILELD VEPGVL L E+ Sbjct: 66 VVTRGAGTGLSGGANASEGCILLALHRLDRILELDPAQGIARVEPGVLNGALDARAREHG 125 Query: 131 LFYPPDPGEKS-ATIAGNISTNAGGMRAVKYGVTRDYVRGLTVVLANGEIIELGGKIVKN 189 L Y PDP + ++I GN++TNAGG +KYGVT D+V L VLA+G I G KN Sbjct: 126 LVYAPDPASRDISSIGGNVATNAGGACCLKYGVTGDHVVALEAVLADGTRIHAGAGTRKN 185 Query: 190 SSGYSLKDLVIGSEGTLCVITKAILKLLPLPKMTLSLLIPFENISDAAGIVPKIIKSKAI 249 +G LK L+IGSEGTL VI ++LLP P+ +L+ F ++ + AG ++++ Sbjct: 186 VAGLDLKRLLIGSEGTLAVIVGVTVRLLPQPQPAGTLIAFFGDL-ERAGQAIVALQARQN 244 Query: 250 PTAIEFMERQTILFAEDFLGKKFPDSSSNAYILLTFDGNTKEQVEAEYETVANLCLAEGA 309 + +E M++ T+ E + D+S+ A I+ D E + AE E LC A A Sbjct: 245 LSRLEVMDQATVAAVEAMTHMEL-DTSTAAMIIAQADSPDSEAILAEAE---RLCEAHDA 300 Query: 310 KDVYIVDTVERKDSVWSARGAFLEAI-KASTTEMDECDVVVPRNRIAEFIEFTHDLAKEM 368 V AR A L A+ K +D DV VP +I E + A+ Sbjct: 301 AMVATTLDEHEGRMFMQARSAALPALEKQGHCLLD--DVAVPIPKIPELLALCAAAAQRH 358 Query: 369 DVRIPSFGHAGDGNLHIYVCRDELCQADWEAKLAEAMDRMYAKALTFEGLVSGEHGIGYA 428 + + +FGH GDGNLH + D A + +A D + A AL G ++GEHG+G Sbjct: 359 GITVATFGHGGDGNLHPTIVYDGQDSAS-VGRARQAFDDIVAGALALGGSITGEHGVGTL 417 Query: 429 KRKYLLNDFGTEHLALMAGIKQTFDPKNLLNPKK 462 KR YL G + LM GIK FDP +LNP K Sbjct: 418 KRAYLTAMAGEREVTLMRGIKGVFDPMGILNPGK 451 Lambda K H 0.318 0.136 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 476 Number of extensions: 23 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 466 Length of database: 453 Length adjustment: 33 Effective length of query: 433 Effective length of database: 420 Effective search space: 181860 Effective search space used: 181860 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory