Align L-arabinose 1-dehydrogenase / D-galactose 1-dehydrogenase (EC 1.1.1.46; EC 1.1.1.48) (characterized)
to candidate WP_043769901.1 U743_RS16435 SDR family oxidoreductase
Query= reanno::pseudo6_N2E2:Pf6N2E2_5967 (272 letters) >NCBI__GCF_000733765.1:WP_043769901.1 Length = 252 Score = 149 bits (376), Expect = 6e-41 Identities = 93/252 (36%), Positives = 137/252 (54%), Gaps = 9/252 (3%) Query: 18 RLKNKVVLLTGAAQGIGEAIVAAFASQQARLVISDIQAEKVETVAAHWRERGADVHALKA 77 +L NK VL+TGAA G+G FA++ A + +SDI + VAA + G HAL+A Sbjct: 2 QLTNKRVLITGAAAGLGRDFALRFATEGAVITVSDIDESGAQAVAAEIKAAGGQAHALRA 61 Query: 78 DVSNQQDLHAMARHAVERHGRIDVLVNCAGVNVFRDPLEMTEEDWRRCFAIDLDGAWYGC 137 DV+ + D+ + AV G +D L+N AG+ + +++E +W R AI++ G ++GC Sbjct: 62 DVTVEADVARLVADAVAAMGGLDCLINNAGIETIKPVTDISEAEWDRLMAINVKGVFFGC 121 Query: 138 KAVLPQMIEQGVGSIINIASTHSSHIIPGCFPYPVAKHGLLGLTRALGIEYAPKGVRVNA 197 K P + E G+IIN+AS P Y +K ++ +++AL E+ GVRVNA Sbjct: 122 KHAFPHLAETH-GNIINLASAAGLIGWPLLSLYCASKGAVIQMSKALSQEFREAGVRVNA 180 Query: 198 IAPGYIETQLNVDYWNGFADPYAERQ--RALDLHPPR--RIGQPIEVAMTAVFLASDEAP 253 + P I T D + F D Y + A D+ R R+G+P EV AVFLASD A Sbjct: 181 LCPMVIAT----DMGSRFKDTYEKEYGVPAGDMLDARQGRLGRPEEVTAAAVFLASDGAS 236 Query: 254 FINASCITIDGG 265 F+N + ID G Sbjct: 237 FVNGVALPIDNG 248 Lambda K H 0.321 0.137 0.419 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 156 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 272 Length of database: 252 Length adjustment: 25 Effective length of query: 247 Effective length of database: 227 Effective search space: 56069 Effective search space used: 56069 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory