Align ATPase (characterized, see rationale)
to candidate WP_043770575.1 U743_RS01110 ATP-binding cassette domain-containing protein
Query= uniprot:Q31RN8 (261 letters) >NCBI__GCF_000733765.1:WP_043770575.1 Length = 219 Score = 134 bits (338), Expect = 1e-36 Identities = 79/220 (35%), Positives = 121/220 (55%), Gaps = 2/220 (0%) Query: 21 MIYAEGVEKWYGNQFQALCGVSLTVQRGEVVVMMGPSGSGKSTFLRTLNALESHQRGEIW 80 MI A G+ Y + L G+ + RGE+ + G SG+GKST L+ + LE G++ Sbjct: 1 MIQATGLRHSYPGSGEILGGLDFELARGEMAFLTGASGAGKSTLLKLIAGLERPAGGQLM 60 Query: 81 IEGHRLSH-DRRDIATIRQEVGMVFQQFNLFPHLTVLQNLMLAPVQVRRWPVAQAEATAR 139 + G L RR +A RQ VG+VFQQ+ L V N+ L P+ +R + R Sbjct: 61 VGGINLPRLPRRRVAGFRQRVGIVFQQYRLLSDRRVYDNVAL-PLIIRGMAPREIGRRVR 119 Query: 140 QLLERVRIAEQADKYPGQLSGGQQQRVAIARALAMQPRILLFDEPTSALDPEMVREVLDV 199 L+ V + + +P LSGG+QQRVAIARA+ +P +LL DEPT LDP + E++ + Sbjct: 120 AALDAVDLLNRERAWPLTLSGGEQQRVAIARAIVAKPELLLADEPTGNLDPALSAEIMTL 179 Query: 200 MRDLASEGMTMLVATHEVGFAREVADRVVLMADGQIVEEA 239 R G+++L+A+H + R + R + + DG++ E A Sbjct: 180 FRRFNEVGVSVLIASHALDLVRSLPCRELALEDGRLREAA 219 Lambda K H 0.321 0.134 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 151 Number of extensions: 8 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 261 Length of database: 219 Length adjustment: 23 Effective length of query: 238 Effective length of database: 196 Effective search space: 46648 Effective search space used: 46648 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory