Align monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized)
to candidate WP_052367418.1 U743_RS01940 glycine betaine/L-proline ABC transporter ATP-binding protein ProV
Query= BRENDA::Q97UY8 (353 letters) >NCBI__GCF_000733765.1:WP_052367418.1 Length = 413 Score = 140 bits (354), Expect = 5e-38 Identities = 77/225 (34%), Positives = 127/225 (56%), Gaps = 1/225 (0%) Query: 16 GKVVALDNVNINIENGERFGILGPSGAGKTTFMRIIAGLDVPSTGELYFDDR-LVASNGK 74 G + + + + + GE F ++G SG+GK+T +R++ L PS+G + + R + ++ + Sbjct: 39 GLTIGVADASFEVAEGEVFVVMGLSGSGKSTLVRMLNRLIEPSSGSIKLNGRDITQASRR 98 Query: 75 LIVPPEDRKIGMVFQTWALYPNLTAFENIAFPLTNMKMSKEEIRKRVEEVAKILDIHHVL 134 ++ R I MVFQ++AL P+ T +N AF L M KEE + E + + Sbjct: 99 ELIEIRRRSISMVFQSFALMPHQTVLQNAAFGLNVAGMKKEEREAKAMEALDAVGLKSNA 158 Query: 135 NHFPRELSGGQQQRVALARALVKDPSLLLLDEPFSNLDARMRDSARALVKEVQSRLGVTL 194 N +P ELSGG +QRV LARAL DP +LL+DE FS LD +R + + +QS T+ Sbjct: 159 NSYPDELSGGMKQRVGLARALATDPEVLLMDEAFSALDPLIRTEMQDELLRLQSEQARTV 218 Query: 195 LVVSHDPADIFAIADRVGVLVKGKLVQVGKPEDLYDNPVSIQVAS 239 + ++HD + + DR+ ++ G +VQ+G PE++ P + V S Sbjct: 219 VFITHDLDEAMRVGDRIAIMQGGWIVQIGTPEEIVRAPANEYVRS 263 Lambda K H 0.319 0.139 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 286 Number of extensions: 20 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 353 Length of database: 413 Length adjustment: 30 Effective length of query: 323 Effective length of database: 383 Effective search space: 123709 Effective search space used: 123709 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory