Align GlpT, component of Glycerol uptake porter, GlpSTPQV (characterized)
to candidate WP_156966353.1 U743_RS06585 heme ABC transporter ATP-binding protein
Query= TCDB::G3LHY9 (356 letters) >NCBI__GCF_000733765.1:WP_156966353.1 Length = 292 Score = 83.6 bits (205), Expect = 6e-21 Identities = 63/207 (30%), Positives = 104/207 (50%), Gaps = 23/207 (11%) Query: 35 GGAYALLGPSGCGKTTLLNIISGLLQPSHGRILFDGKDVTNLSTQSRNIAQV-------- 86 G LLGP+G GK+TLL +++G L+P G + G + + R +A+V Sbjct: 47 GECLMLLGPNGAGKSTLLRVLAGELKPGQGSVAVLGHPLD--AWDGRELARVRGVLPQQC 104 Query: 87 -FQFPVIYDTMTVYDNLAFPLRNRGVAEADVDRRVR-DILEMIDLASWARRKAQGLTADQ 144 QFPV T +L RG A A RVR ++L+ +++A ARR L+ + Sbjct: 105 AVQFPV---TAAEVVDLGLLTTLRGDARA----RVRAELLDWLEVAHLARRIYPSLSGGE 157 Query: 145 KQKISLGRGLVR----NDVNAILFDEPLTVIDPHMKWVLRSQLKRLHKQFGFTMVYVTHD 200 +Q++ + R L + +L DE + +DP + + + LK L + G ++ +HD Sbjct: 158 QQRVQIARVLGQVWKTPGPRLLLLDECTSALDPAQQHAVMAMLKSLSRAAGIGVIVTSHD 217 Query: 201 QTEALTFAEKVVVMYDGQIVQIGTPAE 227 A T+A++V +M DG+I+ TP E Sbjct: 218 LGLAATYADRVALMRDGRIITDATPRE 244 Lambda K H 0.321 0.137 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 211 Number of extensions: 12 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 356 Length of database: 292 Length adjustment: 28 Effective length of query: 328 Effective length of database: 264 Effective search space: 86592 Effective search space used: 86592 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory