Align isovaleryl-CoA dehydrogenase (EC 1.3.8.4) (characterized)
to candidate WP_052367482.1 U743_RS03480 isovaleryl-CoA dehydrogenase
Query= BRENDA::B5UB85 (416 letters) >NCBI__GCF_000733765.1:WP_052367482.1 Length = 403 Score = 331 bits (848), Expect = 3e-95 Identities = 183/387 (47%), Positives = 251/387 (64%), Gaps = 14/387 (3%) Query: 34 GLSEEQQQLRKMVFDFAQKELAPKAAEIDKENNFKELRPFWKKLGDLGLLGITASSDYGG 93 GLS ++ ++ FAQ EL P A +D E + + K+G+ G GITA GG Sbjct: 19 GLSPDEMEILHQADRFAQAELYPLAERMDNEEWWPP--EVFPKIGETGFFGITAPEALGG 76 Query: 94 TGGKYSDHCVIMEELSRASGGIALSYGAHSNLCVNQINRNGTEEQKSKYLPKLCSGEHIG 153 +G ++++ R + +ALS+ AH NLC++ I RN +E QK KY+P +CSG+ IG Sbjct: 77 SGMDVFTSGLVLQAFGRWNHALALSWVAHENLCMHNILRNASEAQKQKYVPGMCSGQLIG 136 Query: 154 ALAMSEPGSGSDVV-SMKLRAEKKGDYYVLNGNKFWITNGPDADVLVVYAKTNWSTSKQQ 212 AL ++EPG+GSD + SM+ A + GD+YVLNG+K +ITNGP ADVL+VYAKT+ + Sbjct: 137 ALGLTEPGAGSDALGSMRTTAYRDGDHYVLNGSKIYITNGPVADVLLVYAKTD--KDRGA 194 Query: 213 HGISAFLIEKDYPGFSTAQKLDKLGMRGSNTGELVFEDCKVPAANLLGQENKGVYVLMSG 272 GISAFL+EKD PGF AQKL K+G RGS T ELVFEDC+VPA NL+G EN+GV V+MSG Sbjct: 195 KGISAFLVEKDTPGFKVAQKLIKMGFRGSQTAELVFEDCRVPAENLVGVENEGVRVVMSG 254 Query: 273 LDLERLVLAAGPVGLMQAAIDTAFLYAHTRKQFGKNIGEFQLIQGKMADMYTTLSACRSY 332 LDLER +++ +G+ + A++ + +A RKQFGK I EFQ+IQ K+A +YT + A R Y Sbjct: 255 LDLERAMISPICLGIAERALELSLEFAKQRKQFGKPISEFQMIQDKIATIYTKVEAMRLY 314 Query: 333 LYNVAKACD--------NGHVNSKDCAGVILYCAEKATQVALDAIQILGGNGYINDYPTG 384 Y +A + G ++ AGV L+ AE +V +A+QI GGNGYI + Sbjct: 315 TYQTLRAANVMGEDDGGRGEIHKLTAAGV-LFVAETMNEVLNEAVQIHGGNGYIWESEIN 373 Query: 385 RILRDAKLYEIGAGTSEVRRMLIGRAL 411 R+ R KL EIGAGTSEVR+++I L Sbjct: 374 RLYRSIKLLEIGAGTSEVRKLIISGEL 400 Lambda K H 0.318 0.135 0.399 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 424 Number of extensions: 17 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 416 Length of database: 403 Length adjustment: 31 Effective length of query: 385 Effective length of database: 372 Effective search space: 143220 Effective search space used: 143220 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory