Align TM1749, component of Probable mannose/mannoside porter. Induced by beta-mannan (Conners et al., 2005). Regulated by mannose-responsive regulator manR (characterized)
to candidate WP_043764717.1 U743_RS00615 ABC transporter ATP-binding protein
Query= TCDB::Q9X271 (324 letters) >NCBI__GCF_000733765.1:WP_043764717.1 Length = 317 Score = 197 bits (502), Expect = 2e-55 Identities = 112/299 (37%), Positives = 168/299 (56%), Gaps = 16/299 (5%) Query: 23 AVDGISYKLNKGESLGIVGESGSGKS--VSVLSLLRLINRNGRIVDGEAIFLGKDLLKLN 80 AVD +S + GE +G+VGESG GKS L+ LR +R I++GE +L Sbjct: 16 AVDDVSLDIRPGEIVGLVGESGCGKSSLARCLAGLRAPDRGAVILNGE---------QLG 66 Query: 81 KEELRNIRGKDISIIFQNPMTSLNPIIRVGIQVMEPI--IWHRLMKNEEARERAIELLER 138 + +R + + + ++FQ+P SL+P +RV + EP+ + L +++ RER LE Sbjct: 67 RRGMRRNQRRAVQMVFQDPTASLDPRMRVNKLLAEPLRALCPELDRHQR-RERIAATLEA 125 Query: 139 VGIPESPKRFLNYPFQFSGGMRQRVMIAMALACHPKLLIADEPTTALDVTIQAQIMELLQ 198 VG+ P + FSGG QR+ IA AL P LLI DEP +ALDV++QAQI+ LL+ Sbjct: 126 VGL--DPAHGQRFAHSFSGGQAQRIAIARALVVEPDLLICDEPLSALDVSVQAQILNLLR 183 Query: 199 ELKEEYGMSVIFITHDLSVATNFCDRIITMYAGKIVEEAPVEEILKTPLHPYTKGLLNST 258 +L+ GM+++FI+HDL+V CDR++ MY G++VE+ +++ P HPYT+ LL+ Sbjct: 184 DLRARRGMAMLFISHDLAVVRQLCDRLLVMYLGRLVEQGATADLIDRPAHPYTRALLSCV 243 Query: 259 LEIGSRGKKLVPIPGNPPNPTKHPSGCKFHPRCSFAMEICQREEPPLVNISENHRVACH 317 + + + + + G P+P PSGC F RC A IC EP ACH Sbjct: 244 PRVVAAAEPQILLEGELPDPRARPSGCVFRTRCPMADGICAEREPDWHRQEHGGYSACH 302 Lambda K H 0.320 0.139 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 246 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 324 Length of database: 317 Length adjustment: 28 Effective length of query: 296 Effective length of database: 289 Effective search space: 85544 Effective search space used: 85544 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory