Align Glycine betaine/proline betaine transport system ATP-binding protein ProV (characterized)
to candidate WP_043769261.1 U743_RS14700 ABC transporter ATP-binding protein
Query= SwissProt::P17328 (400 letters) >NCBI__GCF_000733765.1:WP_043769261.1 Length = 348 Score = 145 bits (366), Expect = 2e-39 Identities = 91/254 (35%), Positives = 135/254 (53%), Gaps = 5/254 (1%) Query: 44 VKDASLAIEEGEIFVIMGLSGSGKSTMVRLLNRLIEPTRGQVLIDGVDIAKISDAELREV 103 ++D + GE ++G SGSGK+T++RLL PT G++ +GV +++ +A E Sbjct: 17 LEDIGFTLARGESAALLGPSGSGKTTLLRLLAGFEAPTAGKISFEGVSLSRAGEAVPPEQ 76 Query: 104 RRKKIAMVFQSFALMPHMTVLDNTAFGMELAGIAAQERREKALDALRQVGLENYAHAYPD 163 RR AMVFQ AL+PH++ LDN G L + R A ++L VGL N P Sbjct: 77 RR--FAMVFQDLALLPHLSALDNVRLG--LYRMPRARSRALAQESLAMVGLGNLGARRPH 132 Query: 164 ELSGGMRQRVGLARALAINPDILLMDEAFSALDPLIRTEMQDELVKLQAKHQRTIVFISH 223 ELSGG QRV +ARA+A P +LLMDEAFS+LD +R +++EL L + T + ++H Sbjct: 133 ELSGGQLQRVAVARAIATRPRLLLMDEAFSSLDEGLRLSLREELRALLRQLGITALLVTH 192 Query: 224 DLDEAMRIGDRIAIMQNGEVVQVGTPDEILNNPANDYVRTFF-RGVDISQVFSAKDIARR 282 EA G + ++ G + Q TP + + PA +V F GV I Sbjct: 193 SHLEAFAFGQWVGVLDAGRLQQWDTPYNLYHRPATRFVAGFVGEGVFIRGELGGNGNYAT 252 Query: 283 SPVGLIRKTPGFGP 296 + +G + +PG P Sbjct: 253 TELGRLPLSPGQSP 266 Lambda K H 0.319 0.137 0.378 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 337 Number of extensions: 18 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 400 Length of database: 348 Length adjustment: 30 Effective length of query: 370 Effective length of database: 318 Effective search space: 117660 Effective search space used: 117660 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory