Align Glycine betaine/proline betaine transport system ATP-binding protein ProV (characterized)
to candidate WP_052367418.1 U743_RS01940 glycine betaine/L-proline ABC transporter ATP-binding protein ProV
Query= SwissProt::P17328 (400 letters) >NCBI__GCF_000733765.1:WP_052367418.1 Length = 413 Score = 454 bits (1167), Expect = e-132 Identities = 233/401 (58%), Positives = 306/401 (76%), Gaps = 6/401 (1%) Query: 1 MAIKLEVKNLYKIFGEHPQRAFKYIEKGLSKEQILEKTGLSLGVKDASLAIEEGEIFVIM 60 M+ KL V+N+YKIFG +P+ A + + +G K+ I E TGL++GV DAS + EGE+FV+M Sbjct: 1 MSTKLAVENVYKIFGGNPKEAMQRVARGEDKDSIFEHTGLTIGVADASFEVAEGEVFVVM 60 Query: 61 GLSGSGKSTMVRLLNRLIEPTRGQVLIDGVDIAKISDAELREVRRKKIAMVFQSFALMPH 120 GLSGSGKST+VR+LNRLIEP+ G + ++G DI + S EL E+RR+ I+MVFQSFALMPH Sbjct: 61 GLSGSGKSTLVRMLNRLIEPSSGSIKLNGRDITQASRRELIEIRRRSISMVFQSFALMPH 120 Query: 121 MTVLDNTAFGMELAGIAAQERREKALDALRQVGLENYAHAYPDELSGGMRQRVGLARALA 180 TVL N AFG+ +AG+ +ER KA++AL VGL++ A++YPDELSGGM+QRVGLARALA Sbjct: 121 QTVLQNAAFGLNVAGMKKEEREAKAMEALDAVGLKSNANSYPDELSGGMKQRVGLARALA 180 Query: 181 INPDILLMDEAFSALDPLIRTEMQDELVKLQAKHQRTIVFISHDLDEAMRIGDRIAIMQN 240 +P++LLMDEAFSALDPLIRTEMQDEL++LQ++ RT+VFI+HDLDEAMR+GDRIAIMQ Sbjct: 181 TDPEVLLMDEAFSALDPLIRTEMQDELLRLQSEQARTVVFITHDLDEAMRVGDRIAIMQG 240 Query: 241 GEVVQVGTPDEILNNPANDYVRTFFRGVDISQVFSAKDIARRSPVGLIRKTPGFGPRSAL 300 G +VQ+GTP+EI+ PAN+YVR+FFRGVD+SQVF+A DIARR + +I + G R+AL Sbjct: 241 GWIVQIGTPEEIVRAPANEYVRSFFRGVDVSQVFTAGDIARRDQLTVIERA-GVSLRAAL 299 Query: 301 KLLQDEDREYGYVIERGNKFVGVVSIDSLKAALSQAQG-----IEAALIDDPLVVDAQTP 355 L+ DR+ V +R KF+GVV+ DSL A L G IE+A I V+A TP Sbjct: 300 SRLEHHDRQVAVVNDRNGKFLGVVTADSLLARLDDVAGDDDCAIESAFIAGDDAVNASTP 359 Query: 356 LSELLSHVGQAPCAVPVVDEEHQYVGIISKRMLLQALDREG 396 L+E+++ V +AP VPVVD++ +Y G IS+ LL LDR G Sbjct: 360 LTEVMTRVAEAPWPVPVVDDDGRYRGTISRATLLLTLDRSG 400 Lambda K H 0.319 0.137 0.378 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 488 Number of extensions: 16 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 400 Length of database: 413 Length adjustment: 31 Effective length of query: 369 Effective length of database: 382 Effective search space: 140958 Effective search space used: 140958 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory