Align D-xylulose reductase (EC 1.1.1.9) (characterized)
to candidate WP_043765547.1 U743_RS03520 SDR family oxidoreductase
Query= BRENDA::Q8GR61 (262 letters) >NCBI__GCF_000733765.1:WP_043765547.1 Length = 262 Score = 114 bits (285), Expect = 2e-30 Identities = 81/259 (31%), Positives = 121/259 (46%), Gaps = 9/259 (3%) Query: 8 KVCLVTGAGGNIGLATALRLAEEGTAIALLDMNREA-LEKAEASVREKGVEAR--SYVCD 64 K+ +++G G +G+ A+ A G A ++ A LE AE VRE + R V D Sbjct: 5 KIIVISGIGTGLGVKLAVEAARAGAAGLVVSARTAAKLEDAEQRVREVNPDCRVLKQVTD 64 Query: 65 VTSEEAVIGTVDSVVRDFGKIDFLFNNAGYQGAFAPVQDYPSDDFARVLTINVTGAFHVL 124 +T E VD+ V +FG+ID L N+A GA D + + N+ G + Sbjct: 65 ITKPEDCQALVDAAVAEFGRIDGLVNSAFVHGAMDHASTADIDSWMEPMATNLFGTLRLT 124 Query: 125 KAVSRQMITQNYGRIVNTASMAGVKGPP-NMAAYGTSKGAIIALTETAALDLAPYNIRVN 183 +AV+RQM Q G IV +MA K PP A Y SKGA+ + A +L P NIRVN Sbjct: 125 QAVARQMQQQKQGAIVMVNTMAARKVPPVGEAGYAASKGALATTVKYLASELGPDNIRVN 184 Query: 184 AISPGYMGPGFMWERQVELQAKVGSQYFSTDPKVVAQQMIGSVPMRRYGDINEIPGVVAF 243 + G+ MW V+ + S+ + + Q+ ++P+R E F Sbjct: 185 TVHMGW-----MWGAPVKGYVEWQSEQSGVPVEEIKGQIAANIPLRIVPPDEECARSALF 239 Query: 244 LLGDDSSFMTGVNLPIAGG 262 + D S +TG +L + GG Sbjct: 240 FVSDYSRVVTGASLDVNGG 258 Lambda K H 0.318 0.135 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 167 Number of extensions: 8 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 262 Length of database: 262 Length adjustment: 25 Effective length of query: 237 Effective length of database: 237 Effective search space: 56169 Effective search space used: 56169 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory