Align D/L-lactic acid transporter; Lactate racemization operon protein LarD; Lactic acid channel (characterized)
to candidate WP_034525928.1 LOSG293_RS00935 aquaporin family protein
Query= SwissProt::F9UST3 (238 letters) >NCBI__GCF_000740055.1:WP_034525928.1 Length = 235 Score = 157 bits (398), Expect = 1e-43 Identities = 83/227 (36%), Positives = 128/227 (56%), Gaps = 7/227 (3%) Query: 6 IAEFMGTALMIIFGVGVHCSSVLKGTKYRGSGHIFAITTWGFGISVALFIFGNVC----I 61 + EF+GT ++I+ G G L T +G +F WG +++ +++ G + + Sbjct: 5 MGEFLGTMILIVLGAGSGAGLNLNKTYAKGQNWLFVSLAWGLAVTMGVYVAGMLGSDGHL 64 Query: 62 NPAMVLAQCLLGNIAWSLFIPYSVAEVLGGVVGSVIVWIMYADHFKASTDEISPITIRNL 121 NPA+ + G WS +PY + + LG +G+ +V I + HFKA+T+E ++ + Sbjct: 65 NPAVTIGFAAFGFFPWSQVLPYLLGQFLGAFIGAALVIIQFTPHFKATTNEAEGNSV-GI 123 Query: 122 FCTAPAVRNLPRNFFVELFDTFIFISGILAISEIKTPGIVPIGVGLLVWAIGMGLGGPTG 181 F T PA++ NF EL TF+F+ +L + T G+ P VG+L+ IGMGLG TG Sbjct: 124 FATRPAIKAPFFNFLSELITTFVFVFILLNLGNF-TEGLKPFIVGMLIAVIGMGLGTTTG 182 Query: 182 FAMNLARDMGPRIAHAILPIANKADSDWQYGIIVPGIAPFVGAAIAA 228 FA+N ARD GPR+A+ ILP+ NK ++W Y VP + P G IAA Sbjct: 183 FAINPARDWGPRLAYTILPVPNKGGAEWSYS-WVPMVGPLAGGLIAA 228 Lambda K H 0.330 0.145 0.470 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 245 Number of extensions: 14 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 238 Length of database: 235 Length adjustment: 23 Effective length of query: 215 Effective length of database: 212 Effective search space: 45580 Effective search space used: 45580 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory