Align Serine transporter, SerP2 or YdgB, of 459 aas and 12 TMSs (Trip et al. 2013). Transports L-alanine (Km = 20 μM), D-alanine (Km = 38 μM), L-serine, D-serine (Km = 356 μM) and glycine (Noens and Lolkema 2015). The encoding gene is adjacent to the one encoding SerP1 (TC# 2.A.3.1.21) (characterized)
to candidate WP_034527992.1 LOSG293_RS05505 amino acid permease
Query= TCDB::F2HQ24 (457 letters) >NCBI__GCF_000740055.1:WP_034527992.1 Length = 458 Score = 404 bits (1038), Expect = e-117 Identities = 204/446 (45%), Positives = 298/446 (66%), Gaps = 2/446 (0%) Query: 2 NTNQNEENKPSQRGLKNRHIQLIAIAGTIGTGLFLGAGKSIHLTGPSIIFVYLIIGALMY 61 NTN E N+ RGL+ RH+QLIA+ GTIGTGLFLGAG+SIHL GPSIIF YLI G + + Sbjct: 4 NTNNQENNQELSRGLQGRHVQLIALGGTIGTGLFLGAGQSIHLAGPSIIFAYLITGIVCF 63 Query: 62 ILLRAIGEMLYQDPNQHSFLNFVSRYLGEKPGYFIQWSYLLVVVFVAMAELIAIGTYINF 121 +L+RA+GE+L D + HSF+ F+S+YLG+ G+ W+Y + + +AMAEL A G Y+ + Sbjct: 64 LLMRALGELLLSDLDAHSFIAFISKYLGKTWGFVAGWTYWICWLTIAMAELTASGLYLRY 123 Query: 122 WLPDLPIWMTEVFVLVLLTLLNTLNPKFFGETEFWFGMIKIVAIIGLILTAIILIFSHYH 181 W P+LP W+T + +L++L L+N++ + FGETEFWF +IKIVAI+GLI I ++ HY Sbjct: 124 WFPNLPEWVTGIAILLILLLINSVTVRAFGETEFWFAIIKIVAILGLIAIGIYMVAVHYK 183 Query: 182 TGTDTVSVTNITKGFEFFPNGLSNFFESFQMVMFAFVSMEFIGMTAAETDNPRPTLKKAI 241 T V N+ KG F NG + F SFQMV+F+FV +E +GMTA+ET NP + KAI Sbjct: 184 TPVGYAEVGNLFKG-GLFANGSNGFLLSFQMVLFSFVGIEMVGMTASETANPTKIIPKAI 242 Query: 242 NQIPIRIVLFYVGALLAIMSIYQWRDIPADKSPFVTIFQLIGIKWAAALVNFVVLTSAAS 301 + IP RI++FY+G+LLA+M IY W++I ++SPFV +F IGI+ AA ++NFVVLT+A S Sbjct: 243 DDIPFRIIIFYLGSLLALMCIYPWQNISPNQSPFVQVFSAIGIRSAATIINFVVLTAAVS 302 Query: 302 ALNSALFSITRNLYSLSKLNNDKILKPFTKFSKAGVPVNALLFTSLLILFTPFISMIPAI 361 A NS+LF+ R L+SL+ K+ +K S+ VP NAL F++++I + F+++ Sbjct: 303 ACNSSLFTTGRMLFSLTYGGKSKLSGKLSKLSRTQVPGNALRFSAIIIAASLFLNLFMP- 361 Query: 362 SNSFVFITSVATNLFLVVYLMTLITYLKYRKSSDFDPKGFVLPAAHIFIPLAIAGFVLIF 421 + F FI+S+AT FL ++ ++ +LKYRK+ F LP A L +A + Sbjct: 362 GHVFTFISSIATTCFLFIWGSIILAHLKYRKTKAAKSAKFKLPFAPFTDYLVLAFLAGVG 421 Query: 422 ISLFCFKDTIVPAIGSVIWVLIFGLF 447 + L +T++ IGS++W++ F Sbjct: 422 LILLMKLETMIALIGSIVWLIALWAF 447 Lambda K H 0.330 0.144 0.431 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 607 Number of extensions: 27 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 457 Length of database: 458 Length adjustment: 33 Effective length of query: 424 Effective length of database: 425 Effective search space: 180200 Effective search space used: 180200 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory