Align phosphopentomutase (EC 5.4.2.7) (characterized)
to candidate WP_034529120.1 LOSG293_RS08055 phosphoglucosamine mutase
Query= BRENDA::Q6I7B6 (450 letters) >NCBI__GCF_000740055.1:WP_034529120.1 Length = 450 Score = 170 bits (431), Expect = 8e-47 Identities = 140/462 (30%), Positives = 218/462 (47%), Gaps = 71/462 (15%) Query: 1 MRLFGTAGIRGTLWEKVTPELAMKVGMAVGTYKSGKA---------LVGRDGRTSSVMLK 51 M+ FGT G+RG +++TPE A K+G A G + A LV D R S ML+ Sbjct: 1 MKYFGTDGVRGVANQELTPEFAFKLGRAGGYVLTQHAEDQNEVPQVLVAHDTRISGQMLE 60 Query: 52 NAMISGLLSTGMEVLDADLIPTPALAWGTRKL-ADAGVMITASHNPPTDNGVKVFNGDGT 110 ++I+GLLS G+EVL +I TP++A+ R A AGVMITASHNP NG+K F DG Sbjct: 61 ESLIAGLLSVGIEVLKLGVITTPSVAYLVRTQGAAAGVMITASHNPVEYNGIKFFGSDGY 120 Query: 111 EFYVEQERGLEEIIFSGNFRKARWDEIKPVRNVEVIPDYINAVLDFV--------GHETN 162 + E E +E+++ S + + + DY ++ G Sbjct: 121 KLSDEMEEEIEQLVDSEDTLPR-----PAAEGLGTVEDYSEGSQKYIQFLEQTISGDLEG 175 Query: 163 LKVLYDGANGAGSLVAPYLLREMGAKV---------LSVNAHVDGHFPGRKPEPRYENIA 213 + + D ANGA S + L ++GA+ L++N V P + Sbjct: 176 MHIAVDSANGATSSLVSRLYADLGAEFDTIATTPNGLNINKGVGSTHPEK---------- 225 Query: 214 YLGKLVRELGVDLAIAQDGDADRIAVFDEKGNYVDEDTVIALFAKLYVEEHG---GGTVV 270 L + V G + +A DGD DR DEKGN VD D ++ + K Y+ EHG +V Sbjct: 226 -LQEFVVSEGAQIGLAFDGDGDRCIAVDEKGNVVDGDKIMYICGK-YMSEHGRLKKDAIV 283 Query: 271 VSIDTGSRIDAVVERAGGRVVRIPLGQPH---DGIKRYKAIFAAEPWKLVHPKFGPWIDP 327 ++ + + +E+ G V+ +G + + +K + + +V F D Sbjct: 284 TTVMSNLGMYKAMEKNGMTSVQTKVGDRYVVEEMLKDGYNLGGEQSGHIVFLDFNTTGDG 343 Query: 328 FVTMGLLIKLIDENG-PLSELVKEIPTYYLKKANVLCPDEYKA---EVVRRAAEEVERKL 383 +T L++++ E G LSEL +E+ Y + NV D+ KA E ++ EVE ++ Sbjct: 344 MLTSLQLLRVMKETGKKLSELAEEVQDYPQELVNVKVTDKKKALNNEKIKAIINEVEAEM 403 Query: 384 SSEIKEVLTISGFRIALNDGSWILIRPSGTEPKIRVVAEAPT 425 + + + +L+RPSGTEP +RV+AEAPT Sbjct: 404 AGDGR-----------------VLVRPSGTEPLLRVMAEAPT 428 Lambda K H 0.318 0.138 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 504 Number of extensions: 20 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 450 Length of database: 450 Length adjustment: 33 Effective length of query: 417 Effective length of database: 417 Effective search space: 173889 Effective search space used: 173889 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory