Align butanoyl-CoA dehydrogenase (NAD+, ferredoxin) (subunit 3/3) (EC 1.3.1.109) (characterized)
to candidate WP_034526014.1 LOSG293_RS01115 electron transfer flavoprotein subunit beta/FixA family protein
Query= BRENDA::D2RIQ2 (263 letters) >NCBI__GCF_000740055.1:WP_034526014.1 Length = 257 Score = 183 bits (465), Expect = 3e-51 Identities = 112/259 (43%), Positives = 157/259 (60%), Gaps = 8/259 (3%) Query: 1 MNIVVCVKQVPDTAEMKIDPVTNNLVRDGVTNIMNPYDQYALETALQLKDELGAHVTVIT 60 M IVVC+KQVP ++KIDP TNNL R V +N YD+ A+E ALQLK++ G V +++ Sbjct: 1 MKIVVCIKQVP-VGDVKIDPKTNNLARSNVEGDINTYDRNAIEAALQLKEQAGGEVILLS 59 Query: 61 MGPPHAESVLRDCLAVGADEAKLVSDRAFGGADTLATSAAMANTIKHFGVPDLILCGRQA 120 MGP S LRD LA+G D A L+S RAFGGADTLAT+ ++ IK G DLIL GRQ+ Sbjct: 60 MGPDSYMSSLRDGLAMGTDSAVLMSSRAFGGADTLATAYTLSEGIKKIGGVDLILFGRQS 119 Query: 121 IDGDTAQVGPEIAEHLGLPQVTAALKVQVKDDTVVVDR---DNEQMSMTFTMKMPCVVTV 177 +D DT QVGP +AE L +PQ+T A V++ DD V+V DN + T +P V+TV Sbjct: 120 VDADTGQVGPIVAEDLNIPQITFAEGVELHDDNVLVGTRLLDNSVQEVKVT--LPAVLTV 177 Query: 178 MRSKDL-RFASIRGKMKARKAEIPVYTAAALEIPLDIIGKAGSPTQVMKSFTPKVTQVHG 236 + R+ + + + + V++ L++ IG+AGSPT V K ++P Sbjct: 178 RAEMNKPRYETPLNIQTSFEKPVTVWSEKDLDLDESRIGQAGSPTIVRKVYSPDKAAKQI 237 Query: 237 EIFDDEDPAVAVDKLVNKL 255 E+ ++ A AV KL+ +L Sbjct: 238 EML-PQNAAAAVTKLLTEL 255 Lambda K H 0.318 0.133 0.375 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 175 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 263 Length of database: 257 Length adjustment: 24 Effective length of query: 239 Effective length of database: 233 Effective search space: 55687 Effective search space used: 55687 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory