Align lactate dehydrogenase (NAD+, ferredoxin) (subunit 3/3) (EC 1.3.1.110) (characterized)
to candidate WP_034526014.1 LOSG293_RS01115 electron transfer flavoprotein subunit beta/FixA family protein
Query= BRENDA::H6LBB0 (264 letters) >NCBI__GCF_000740055.1:WP_034526014.1 Length = 257 Score = 172 bits (435), Expect = 8e-48 Identities = 102/261 (39%), Positives = 154/261 (59%), Gaps = 9/261 (3%) Query: 1 MKILVCIKQVPGTSNVEVDPETGVLIRDGVESKLNPYDLFGLETAFRLKEQLGGTITTLS 60 MKI+VCIKQVP +V++DP+T L R VE +N YD +E A +LKEQ GG + LS Sbjct: 1 MKIVVCIKQVP-VGDVKIDPKTNNLARSNVEGDINTYDRNAIEAALQLKEQAGGEVILLS 59 Query: 61 MGPMQSKEVLMESFYMGADEGCLLSDRKFGGADVVATSYTLAQGTKRLGDFDLIICGKQT 120 MGP L + MG D L+S R FGGAD +AT+YTL++G K++G DLI+ G+Q+ Sbjct: 60 MGPDSYMSSLRDGLAMGTDSAVLMSSRAFGGADTLATAYTLSEGIKKIGGVDLILFGRQS 119 Query: 121 TDGDTAQVGPEMAEFLGIPHVTNVIKILAADEKGLTLQMNMEESLEIQRVPYPCLITVDK 180 D DT QVGP +AE L IP +T + D+ L ++ S++ +V P ++TV Sbjct: 120 VDADTGQVGPIVAEDLNIPQITFAEGVELHDDNVLVGTRLLDNSVQEVKVTLPAVLTVRA 179 Query: 181 DIYTPRLPSYKRKLDISKNPE--IKILTLKDMYDTNEKKYGLSGSPTQVERIFPPESNVE 238 ++ PR Y+ L+I + E + + + KD+ D +E + G +GSPT V +++ P+ + Sbjct: 180 EMNKPR---YETPLNIQTSFEKPVTVWSEKDL-DLDESRIGQAGSPTIVRKVYSPDKAAK 235 Query: 239 KTSFEGDGKVLAKALLGILTE 259 + E + A A+ +LTE Sbjct: 236 Q--IEMLPQNAAAAVTKLLTE 254 Lambda K H 0.316 0.137 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 189 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 264 Length of database: 257 Length adjustment: 25 Effective length of query: 239 Effective length of database: 232 Effective search space: 55448 Effective search space used: 55448 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory