Protein WP_051904483.1 in Hippea jasoniae Mar08-272r
Annotation: NCBI__GCF_000744435.1:WP_051904483.1
Length: 346 amino acids
Source: GCF_000744435.1 in NCBI
Candidate for 30 steps in catabolism of small carbon sources
Pathway | Step | Score | Similar to | Id. | Cov. | Bits | Other hit | Other id. | Other bits |
D-maltose catabolism | malK1 | lo | MalK; aka Sugar ABC transporter, ATP-binding protein, component of The maltose, maltotriose, mannotetraose (MalE1)/maltose, maltotriose, trehalose (MalE2) porter (Nanavati et al., 2005). For MalG1 (823aas) and MalG2 (833aas), the C-terminal transmembrane domain with 6 putative TMSs is preceded by a single N-terminal TMS and a large (600 residue) hydrophilic region showing sequence similarity to MLP1 and 2 (9.A.14; e-12 & e-7) as well as other proteins (characterized) | 34% | 85% | 157.9 | WtpC, component of Tungsten (KM=20pM)/molybdate (KM=10nM) porter | 32% | 177.9 |
trehalose catabolism | thuK | lo | MalK; aka Sugar ABC transporter, ATP-binding protein, component of The maltose, maltotriose, mannotetraose (MalE1)/maltose, maltotriose, trehalose (MalE2) porter (Nanavati et al., 2005). For MalG1 (823aas) and MalG2 (833aas), the C-terminal transmembrane domain with 6 putative TMSs is preceded by a single N-terminal TMS and a large (600 residue) hydrophilic region showing sequence similarity to MLP1 and 2 (9.A.14; e-12 & e-7) as well as other proteins (characterized) | 34% | 85% | 157.9 | WtpC, component of Tungsten (KM=20pM)/molybdate (KM=10nM) porter | 32% | 177.9 |
D-maltose catabolism | malK_Sm | lo | MalK, component of Maltose/Maltotriose/maltodextrin (up to 7 glucose units) transporters MalXFGK (MsmK (3.A.1.1.28) can probably substitute for MalK; Webb et al., 2008) (characterized) | 34% | 72% | 151.8 | WtpC, component of Tungsten (KM=20pM)/molybdate (KM=10nM) porter | 32% | 177.9 |
trehalose catabolism | malK | lo | MalK, component of Maltose/Maltotriose/maltodextrin (up to 7 glucose units) transporters MalXFGK (MsmK (3.A.1.1.28) can probably substitute for MalK; Webb et al., 2008) (characterized) | 34% | 72% | 151.8 | WtpC, component of Tungsten (KM=20pM)/molybdate (KM=10nM) porter | 32% | 177.9 |
putrescine catabolism | potA | lo | Spermidine/putrescine import ATP-binding protein PotA, component of The spermidine/putrescine uptake porter, PotABCD (characterized) | 31% | 84% | 151.4 | WtpC, component of Tungsten (KM=20pM)/molybdate (KM=10nM) porter | 32% | 177.9 |
L-arabinose catabolism | araV | lo | AraV, component of Arabinose, fructose, xylose porter (characterized) | 32% | 83% | 150.2 | WtpC, component of Tungsten (KM=20pM)/molybdate (KM=10nM) porter | 32% | 177.9 |
D-fructose catabolism | araV | lo | AraV, component of Arabinose, fructose, xylose porter (characterized) | 32% | 83% | 150.2 | WtpC, component of Tungsten (KM=20pM)/molybdate (KM=10nM) porter | 32% | 177.9 |
sucrose catabolism | araV | lo | AraV, component of Arabinose, fructose, xylose porter (characterized) | 32% | 83% | 150.2 | WtpC, component of Tungsten (KM=20pM)/molybdate (KM=10nM) porter | 32% | 177.9 |
D-xylose catabolism | araV | lo | AraV, component of Arabinose, fructose, xylose porter (characterized) | 32% | 83% | 150.2 | WtpC, component of Tungsten (KM=20pM)/molybdate (KM=10nM) porter | 32% | 177.9 |
D-maltose catabolism | thuK | lo | Trehalose/maltose import ATP-binding protein MalK; EC 7.5.2.1 (characterized) | 31% | 81% | 149.8 | WtpC, component of Tungsten (KM=20pM)/molybdate (KM=10nM) porter | 32% | 177.9 |
D-cellobiose catabolism | gtsD | lo | Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) | 32% | 83% | 149.1 | WtpC, component of Tungsten (KM=20pM)/molybdate (KM=10nM) porter | 32% | 177.9 |
D-glucose catabolism | gtsD | lo | Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) | 32% | 83% | 149.1 | WtpC, component of Tungsten (KM=20pM)/molybdate (KM=10nM) porter | 32% | 177.9 |
lactose catabolism | gtsD | lo | Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) | 32% | 83% | 149.1 | WtpC, component of Tungsten (KM=20pM)/molybdate (KM=10nM) porter | 32% | 177.9 |
D-maltose catabolism | gtsD | lo | Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) | 32% | 83% | 149.1 | WtpC, component of Tungsten (KM=20pM)/molybdate (KM=10nM) porter | 32% | 177.9 |
D-mannose catabolism | TT_C0211 | lo | Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) | 32% | 83% | 149.1 | WtpC, component of Tungsten (KM=20pM)/molybdate (KM=10nM) porter | 32% | 177.9 |
sucrose catabolism | gtsD | lo | Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) | 32% | 83% | 149.1 | WtpC, component of Tungsten (KM=20pM)/molybdate (KM=10nM) porter | 32% | 177.9 |
sucrose catabolism | thuK | lo | Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) | 32% | 83% | 149.1 | WtpC, component of Tungsten (KM=20pM)/molybdate (KM=10nM) porter | 32% | 177.9 |
trehalose catabolism | gtsD | lo | Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) | 32% | 83% | 149.1 | WtpC, component of Tungsten (KM=20pM)/molybdate (KM=10nM) porter | 32% | 177.9 |
D-cellobiose catabolism | glcV | lo | monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) | 30% | 96% | 147.9 | WtpC, component of Tungsten (KM=20pM)/molybdate (KM=10nM) porter | 32% | 177.9 |
D-galactose catabolism | glcV | lo | monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) | 30% | 96% | 147.9 | WtpC, component of Tungsten (KM=20pM)/molybdate (KM=10nM) porter | 32% | 177.9 |
D-glucose catabolism | glcV | lo | monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) | 30% | 96% | 147.9 | WtpC, component of Tungsten (KM=20pM)/molybdate (KM=10nM) porter | 32% | 177.9 |
lactose catabolism | glcV | lo | monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) | 30% | 96% | 147.9 | WtpC, component of Tungsten (KM=20pM)/molybdate (KM=10nM) porter | 32% | 177.9 |
D-maltose catabolism | glcV | lo | monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) | 30% | 96% | 147.9 | WtpC, component of Tungsten (KM=20pM)/molybdate (KM=10nM) porter | 32% | 177.9 |
D-mannose catabolism | glcV | lo | monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) | 30% | 96% | 147.9 | WtpC, component of Tungsten (KM=20pM)/molybdate (KM=10nM) porter | 32% | 177.9 |
sucrose catabolism | glcV | lo | monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) | 30% | 96% | 147.9 | WtpC, component of Tungsten (KM=20pM)/molybdate (KM=10nM) porter | 32% | 177.9 |
trehalose catabolism | glcV | lo | monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) | 30% | 96% | 147.9 | WtpC, component of Tungsten (KM=20pM)/molybdate (KM=10nM) porter | 32% | 177.9 |
D-maltose catabolism | malK | lo | Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 (characterized) | 30% | 92% | 143.7 | WtpC, component of Tungsten (KM=20pM)/molybdate (KM=10nM) porter | 32% | 177.9 |
D-cellobiose catabolism | msiK | lo | MsiK protein, component of The cellobiose/cellotriose (and possibly higher cellooligosaccharides), CebEFGMsiK [MsiK functions to energize several ABC transporters including those for maltose/maltotriose and trehalose] (characterized) | 30% | 76% | 129.8 | WtpC, component of Tungsten (KM=20pM)/molybdate (KM=10nM) porter | 32% | 177.9 |
D-cellobiose catabolism | SMc04256 | lo | ABC transporter for D-Cellobiose and D-Salicin, ATPase component (characterized) | 35% | 63% | 129 | WtpC, component of Tungsten (KM=20pM)/molybdate (KM=10nM) porter | 32% | 177.9 |
D-maltose catabolism | musK | lo | ABC-type maltose transporter (EC 7.5.2.1) (characterized) | 32% | 58% | 126.7 | WtpC, component of Tungsten (KM=20pM)/molybdate (KM=10nM) porter | 32% | 177.9 |
Sequence Analysis Tools
View WP_051904483.1 at NCBI
Find papers: PaperBLAST
Find functional residues: SitesBLAST
Search for conserved domains
Find the best match in UniProt
Compare to protein structures
Predict transmenbrane helices: Phobius
Predict protein localization: PSORTb
Find homologs in fast.genomics
Fitness BLAST: loading...
Sequence
MIQADIKKQLKNIVIDARINFKGLKNVLFGSSGSGKTSILKMIAGFFDPDEGYIKVNDTL
LFDSSKKFSLKVNLRGVGYIPQEYTLFPHLNVYENIVYGIRARKLKVDNKNLNELINLFG
ISDYLTYKPEELSGGQKQRIAVLRALVAQPKLLLLDEPFSALDRPVREQLRELVEEVIER
FEIPSIFVSHDFEEAYLFADEIAVIENGRIIKTKEKYEMFNKPCCVSVARLFGVKNIFKI
KQKKGNLVKIGNIWIEGAKGRGGYLCIKASDVMVLREDVDVSDKENRFYGVVKSVEDRGF
YVAIKVAIDGLEIYVDVLPHVVYKMEIKKGRRILISLKKEGLVVCN
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Links
Downloads
Related tools
About GapMind
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using
ublast (a fast alternative to protein BLAST)
against a database of manually-curated proteins (most of which are experimentally characterized) or by using
HMMer with enzyme models (usually from
TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
- ublast finds a hit to a characterized protein at above 40% identity and 80% coverage, and bits >= other bits+10.
- (Hits to curated proteins without experimental data as to their function are never considered high confidence.)
- HMMer finds a hit with 80% coverage of the model, and either other identity < 40 or other coverage < 0.75.
where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").
Otherwise, a candidate is "medium confidence" if either:
- ublast finds a hit at above 40% identity and 70% coverage (ignoring otherBits).
- ublast finds a hit at above 30% identity and 80% coverage, and bits >= other bits.
- HMMer finds a hit (regardless of coverage or other bits).
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps."
For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways.
For diverse bacteria and archaea that can utilize a carbon source, there is a complete
high-confidence catabolic pathway (including a transporter) just 38% of the time, and
there is a complete medium-confidence pathway 63% of the time.
Gaps may be due to:
- our ignorance of proteins' functions,
- omissions in the gene models,
- frame-shift errors in the genome sequence, or
- the organism lacks the pathway.
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory