Align BztD, component of Glutamate/glutamine/aspartate/asparagine porter (characterized)
to candidate WP_035587918.1 EK17_RS04610 phosphate ABC transporter ATP-binding protein
Query= TCDB::Q52666 (263 letters) >NCBI__GCF_000744435.1:WP_035587918.1 Length = 252 Score = 141 bits (355), Expect = 2e-38 Identities = 86/255 (33%), Positives = 144/255 (56%), Gaps = 12/255 (4%) Query: 17 VSDEIAIQISQMNKWYGQFHVLRDINLTVHRGERIVIAGPSGSGKSTMIRCINRLEE--- 73 +S+ I I + +N +YG VL+DINL++++ + + GPSG GK+T +RC NR+ + Sbjct: 1 MSENILISVEHLNFYYGNNQVLKDINLSIYKNKITALIGPSGCGKTTFLRCFNRMHDLYK 60 Query: 74 --HQSGKIIVDGIELTSDLKNIDKVRSEVGMVFQHFNLFPHLTILENLTLAPIWVRKVPK 131 GKII G + + K I ++R ++GMVFQ FP ++I +N+ K Sbjct: 61 NNRYEGKIIYQGENILT-TKRIIELRGKIGMVFQKPTPFP-MSIFDNVAYGLKLKGVKNK 118 Query: 132 REAEETAMYYLEKV----KIPEQAQKYPGQLSGGQQQRVAIARSLCMKPKIMLFDEPTSA 187 E E L++ ++ ++ + LSGGQQQR+ IAR L ++P I+LFDEPTSA Sbjct: 119 EEIRERVEKALKQAALWDEVKDKLFESGLSLSGGQQQRLVIARVLAVEPDIILFDEPTSA 178 Query: 188 LDPEMIKEVLDTMIQLAEEGMTMLCVTHEMGFAQAVANRVIFMADGQIVEQNNPHDFFHN 247 LDP ++ + + +L + T+L VTH M A +++ F+ G+++E + F N Sbjct: 179 LDPIATAKIEELVSEL-KNITTILIVTHNMQQAARISDFTAFLFKGELIEFSETEKLFTN 237 Query: 248 PQSERTKQFLSQILG 262 P+ E T+++++ G Sbjct: 238 PEKELTERYITGRFG 252 Lambda K H 0.320 0.134 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 160 Number of extensions: 6 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 263 Length of database: 252 Length adjustment: 24 Effective length of query: 239 Effective length of database: 228 Effective search space: 54492 Effective search space used: 54492 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory