Align PEB1C, component of Uptake system for glutamate and aspartate (characterized)
to candidate WP_035587918.1 EK17_RS04610 phosphate ABC transporter ATP-binding protein
Query= TCDB::A3ZI83 (242 letters) >NCBI__GCF_000744435.1:WP_035587918.1 Length = 252 Score = 134 bits (337), Expect = 2e-36 Identities = 86/246 (34%), Positives = 141/246 (57%), Gaps = 14/246 (5%) Query: 1 MIELKNVNKYYGTHHVLKNINLSVKEGEKLVIIGPSGSGKSTTIRCMNGLEEV-----SS 55 +I ++++N YYG + VLK+INLS+ + + +IGPSG GK+T +RC N + ++ Sbjct: 6 LISVEHLNFYYGNNQVLKDINLSIYKNKITALIGPSGCGKTTFLRCFNRMHDLYKNNRYE 65 Query: 56 GEVVV-NNLVLNHKNKIEICRKYCAMVFQHFNLYPHMTVLQNLTLAPMKLQKKSKKEAEE 114 G+++ +L K IE+ R MVFQ +P M++ N+ K+K+E E Sbjct: 66 GKIIYQGENILTTKRIIEL-RGKIGMVFQKPTPFP-MSIFDNVAYGLKLKGVKNKEEIRE 123 Query: 115 TAFKYLKVVGLLD--KANVYPA--TLSGGQQQRVAIARSLCTKKPYILFDEPTSALDPET 170 K LK L D K ++ + +LSGGQQQR+ IAR L + ILFDEPTSALDP Sbjct: 124 RVEKALKQAALWDEVKDKLFESGLSLSGGQQQRLVIARVLAVEPDIILFDEPTSALDPIA 183 Query: 171 IQEVLDVMKEISHQSNTTMVVVTHEMGFAKEVADRIIFMEDGAIVEENIPSEFFSNPKTE 230 ++ +++ E+ ++ TT+++VTH M A ++D F+ G ++E + + F+NP+ E Sbjct: 184 TAKIEELVSEL--KNITTILIVTHNMQQAARISDFTAFLFKGELIEFSETEKLFTNPEKE 241 Query: 231 RARLFL 236 ++ Sbjct: 242 LTERYI 247 Lambda K H 0.317 0.133 0.372 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 166 Number of extensions: 6 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 242 Length of database: 252 Length adjustment: 24 Effective length of query: 218 Effective length of database: 228 Effective search space: 49704 Effective search space used: 49704 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory