Align TM0028, component of β-glucoside porter (Conners et al., 2005). Binds cellobiose, laminaribiose (Nanavati et al. 2006). Regulated by cellobiose-responsive repressor BglR (characterized)
to candidate WP_035586760.1 EK17_RS01085 ATP-binding cassette domain-containing protein
Query= TCDB::Q9WXN5 (330 letters) >NCBI__GCF_000744435.1:WP_035586760.1 Length = 328 Score = 221 bits (562), Expect = 3e-62 Identities = 132/324 (40%), Positives = 189/324 (58%), Gaps = 15/324 (4%) Query: 2 KEILLKAENVRAYYKLEKVSVKAVDGLSFEILEDEVIGVVGESGCGKTTLSNVIFMNMVK 61 KE LK + A +K EK VKAVD +SFEI + E +GVVGESG GKTTL I + +V+ Sbjct: 14 KEFELKRPWLEAIFKREKPIVKAVDNVSFEIKKGETLGVVGESGSGKTTLGRTI-IRLVE 72 Query: 62 PLTLVDGKIFLRVNGEFVELSSMTRDEVKRKFWGKEITIIPQAAMNALMPTIRMEKYVRH 121 P G IF + + ++++++K+ ++ II Q M +L P + + + + H Sbjct: 73 PTR---GSIFF----DSYYIEKLSKEQLKKA--RRDFQIIFQDPMASLNPYMSVGQTISH 123 Query: 122 LAESH-GIDEEELLDKARRRFEEVGLDPL--WIKRYPFELSGGMRQRAVIAIATILNPSL 178 E H + ++ K E V L P + RYP LSGG RQR VIA A I NP Sbjct: 124 PLEIHTNLSRGQIKQKVLEILELVNLSPAEDFYNRYPKYLSGGQRQRVVIARALITNPKF 183 Query: 179 LIADEPTSALDVVNQKVLLKVLMQMKRQGIVKSIIFITHDIATVRQIADRMIIMYAGKIV 238 ++ADEPT+ LDV + +LK+++ +K++ + + +FITHD+A+ + I DR+ +MY G IV Sbjct: 184 VVADEPTAMLDVSVRSQILKLMINLKKE-LKLTYLFITHDLASAKYICDRIAVMYLGSIV 242 Query: 239 EFAPVESLLEKPLHPYTQGLFNSVLTPEPEVKKRGITTIPGAPPNLINPPSGCRFHPRCP 298 E A + PLHPYT+ L +S+ P+P +K+ I G P+ PSGCRFH RCP Sbjct: 243 EIAKTYDIFTNPLHPYTKILLSSIPVPDPNIKREKILP-KGEIPSATKIPSGCRFHTRCP 301 Query: 299 HAMDVCKEKEPPLTEIEPGRRVAC 322 A D C + EP L E+E GR VAC Sbjct: 302 FAKDKCSKVEPALKEVEKGRFVAC 325 Lambda K H 0.321 0.138 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 296 Number of extensions: 12 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 330 Length of database: 328 Length adjustment: 28 Effective length of query: 302 Effective length of database: 300 Effective search space: 90600 Effective search space used: 90600 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory