Align ATP-binding component of a broad range amino acid ABC transporter (characterized, see rationale)
to candidate WP_035587689.1 EK17_RS04045 ABC transporter ATP-binding protein
Query= uniprot:Q1MCU2 (292 letters) >NCBI__GCF_000744435.1:WP_035587689.1 Length = 252 Score = 171 bits (434), Expect = 1e-47 Identities = 102/263 (38%), Positives = 150/263 (57%), Gaps = 12/263 (4%) Query: 9 MSDDTLLKVEHLSMKFGGLMAINDFSFEAKRGDITALIGPNGAGKTTVFNCITGFYKPTM 68 M LL++ + FGG+ A++ SF+ + I A++GPNGAGKTT+FN ITG YK Sbjct: 1 MEKKPLLRIYDVYKSFGGIRAVDGVSFDLFKKQIKAVVGPNGAGKTTLFNIITGLYKADR 60 Query: 69 GMITFNQKSGKQYLLERLPDFRITKEARVARTFQNIRLFSGLTVLENLLVAQHNKLMKAS 128 G I + + ++ K+ +ARTFQNI+L S LTV EN+ + H+ Sbjct: 61 GKIELFGED-----ITNCKSHKLIKKG-IARTFQNIQLISDLTVFENIAIGAHHLFETNL 114 Query: 129 GYTILGLIGVGPYKREAAEAIELARFWLEKADLIDRADDPAGDLPYGAQRRLEIARAMCT 188 LGL YK+ + E ++ + + + D +LP+G +R +EI RA+ + Sbjct: 115 LEAFLGL-----YKKNEKKVFEKLKWIIRFLKIEEYVDLYPDELPFGIKRIVEIGRAIAS 169 Query: 189 GPELLCLDEPAAGLNPRESATLNALLKSIRAETGTSILLIEHDMSVVMEISDHVVVLEYG 248 P+LL LDEPAAGLN ES L ++ + E GT+ILLI+HD+ V S +VV++ G Sbjct: 170 NPKLLLLDEPAAGLNESESEQLLNIIFRV-WERGTTILLIDHDIEFVASCSHSIVVMDSG 228 Query: 249 QKISDGTPDHVKNDPRVIAAYLG 271 +KI++G P V ND RVI AY+G Sbjct: 229 KKIAEGLPSEVLNDERVIRAYIG 251 Lambda K H 0.318 0.136 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 165 Number of extensions: 11 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 292 Length of database: 252 Length adjustment: 25 Effective length of query: 267 Effective length of database: 227 Effective search space: 60609 Effective search space used: 60609 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory