Align ATP-binding component of a broad range amino acid ABC transporter (characterized, see rationale)
to candidate WP_035586824.1 EK17_RS01295 ABC transporter ATP-binding protein
Query= uniprot:Q1MCU2 (292 letters) >NCBI__GCF_000744435.1:WP_035586824.1 Length = 253 Score = 167 bits (423), Expect = 2e-46 Identities = 106/261 (40%), Positives = 147/261 (56%), Gaps = 18/261 (6%) Query: 12 DTLLKVEHLSMKFGGLMAINDFSFEAKRGDITALIGPNGAGKTTVFNCITGFYKPTMGMI 71 + +L V+++ + FGGL AI+ SF + I +IGPNGAGKTT+FN I+G KPT G + Sbjct: 5 EKILTVDNIVVDFGGLRAIDGVSFSVDKEKIFGIIGPNGAGKTTLFNVISGHLKPTSGRV 64 Query: 72 TFNQKSGKQYLLERLPDFRITKEARVARTFQNIRLFSGLTVLENLLVAQHNKLMKASGYT 131 F + RL + RTFQ +R F ++V EN+ VA Y Sbjct: 65 FFRGVDVGSFSAYRL------ARMGIGRTFQLVRPFGSMSVEENVFVA----------YG 108 Query: 132 ILGLIGVGPYKR-EAAEAIELARFWLEKADLIDRADDPAGDLPYGAQRRLEIARAMCTGP 190 + ++R + + IE LE LI+ D A LP G QRRLEIARA+ P Sbjct: 109 VRFYYSAKVFERFKKKKYIENVERILELTGLIEFKDKIASKLPLGYQRRLEIARALAVNP 168 Query: 191 ELLCLDEPAAGLNPRESATLNALLKSIRAETGTSILLIEHDMSVVMEISDHVVVLEYGQK 250 LL LDE +GL+ E +L LL+ I E G ++LLIEH+M VVM++ VVV+ YG+K Sbjct: 169 SLLLLDESFSGLSFSEIDSLKLLLREINKE-GITVLLIEHNMPVVMDLCSEVVVVNYGKK 227 Query: 251 ISDGTPDHVKNDPRVIAAYLG 271 I+ G+P+ V ++P VI AYLG Sbjct: 228 IAQGSPEEVASNPVVIEAYLG 248 Lambda K H 0.318 0.136 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 182 Number of extensions: 9 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 292 Length of database: 253 Length adjustment: 25 Effective length of query: 267 Effective length of database: 228 Effective search space: 60876 Effective search space used: 60876 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory