Align TM1749, component of Probable mannose/mannoside porter. Induced by beta-mannan (Conners et al., 2005). Regulated by mannose-responsive regulator manR (characterized)
to candidate WP_035586760.1 EK17_RS01085 ATP-binding cassette domain-containing protein
Query= TCDB::Q9X271 (324 letters) >NCBI__GCF_000744435.1:WP_035586760.1 Length = 328 Score = 249 bits (637), Expect = 5e-71 Identities = 134/312 (42%), Positives = 196/312 (62%), Gaps = 8/312 (2%) Query: 10 LKVEFHRVEGIVKAVDGISYKLNKGESLGIVGESGSGKSVSVLSLLRLINRNGRIVDGEA 69 L+ F R + IVKAVD +S+++ KGE+LG+VGESGSGK+ +++RL+ G Sbjct: 23 LEAIFKREKPIVKAVDNVSFEIKKGETLGVVGESGSGKTTLGRTIIRLVEPTR----GSI 78 Query: 70 IFLGKDLLKLNKEELRNIRGKDISIIFQNPMTSLNPIIRVGIQVMEPIIWHRLMKNEEAR 129 F + KL+KE+L+ R +D IIFQ+PM SLNP + VG + P+ H + + + Sbjct: 79 FFDSYYIEKLSKEQLKKAR-RDFQIIFQDPMASLNPYMSVGQTISHPLEIHTNLSRGQIK 137 Query: 130 ERAIELLERVGIPESPKRFLNYPFQFSGGMRQRVMIAMALACHPKLLIADEPTTALDVTI 189 ++ +E+LE V + + + YP SGG RQRV+IA AL +PK ++ADEPT LDV++ Sbjct: 138 QKVLEILELVNLSPAEDFYNRYPKYLSGGQRQRVVIARALITNPKFVVADEPTAMLDVSV 197 Query: 190 QAQIMELLQELKEEYGMSVIFITHDLSVATNFCDRIITMYAGKIVEEAPVEEILKTPLHP 249 ++QI++L+ LK+E ++ +FITHDL+ A CDRI MY G IVE A +I PLHP Sbjct: 198 RSQILKLMINLKKELKLTYLFITHDLASAKYICDRIAVMYLGSIVEIAKTYDIFTNPLHP 257 Query: 250 YTKGLLNS--TLEIGSRGKKLVPIPGNPPNPTKHPSGCKFHPRCSFAMEICQREEPPLVN 307 YTK LL+S + + +K++P G P+ TK PSGC+FH RC FA + C + EP L Sbjct: 258 YTKILLSSIPVPDPNIKREKILP-KGEIPSATKIPSGCRFHTRCPFAKDKCSKVEPALKE 316 Query: 308 ISENHRVACHLI 319 + + VACH + Sbjct: 317 VEKGRFVACHYV 328 Lambda K H 0.320 0.139 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 306 Number of extensions: 16 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 324 Length of database: 328 Length adjustment: 28 Effective length of query: 296 Effective length of database: 300 Effective search space: 88800 Effective search space used: 88800 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory