Align TM1750, component of Probable mannose/mannoside porter. Induced by beta-mannan (Conners et al., 2005). Regulated by mannose-responsive regulator manR (characterized)
to candidate WP_035586760.1 EK17_RS01085 ATP-binding cassette domain-containing protein
Query= TCDB::Q9X272 (328 letters) >NCBI__GCF_000744435.1:WP_035586760.1 Length = 328 Score = 295 bits (756), Expect = 8e-85 Identities = 150/307 (48%), Positives = 211/307 (68%), Gaps = 3/307 (0%) Query: 19 LKKYFPQGKRILKAVDGISIEIKEGETLGLVGESGCGKSTLGRTILKLLRPDGGKIFFEG 78 L+ F + K I+KAVD +S EIK+GETLG+VGESG GK+TLGRTI++L+ P G IFF+ Sbjct: 23 LEAIFKREKPIVKAVDNVSFEIKKGETLGVVGESGSGKTTLGRTIIRLVEPTRGSIFFDS 82 Query: 79 KDITNLNDKEMKPYRKKMQIIFQDPLGSLNPQMTVGRIIEDPLIIHKIGTKKERRKRVEE 138 I L+ +++K R+ QIIFQDP+ SLNP M+VG+ I PL IH ++ + +++V E Sbjct: 83 YYIEKLSKEQLKKARRDFQIIFQDPMASLNPYMSVGQTISHPLEIHTNLSRGQIKQKVLE 142 Query: 139 LLDMVGIG--REFINSFPHEFSGGQQQRIGIARALALNPKFIVCDEPVSALDVSIQAQII 196 +L++V + +F N +P SGGQ+QR+ IARAL NPKF+V DEP + LDVS+++QI+ Sbjct: 143 ILELVNLSPAEDFYNRYPKYLSGGQRQRVVIARALITNPKFVVADEPTAMLDVSVRSQIL 202 Query: 197 DLLEEIQQKMGISYLFIAHNLAVVEHISHKVAVMYLGKIVEYGDVDKIFLNPIHPYTRAL 256 L+ +++++ ++YLFI H+LA ++I ++AVMYLG IVE IF NP+HPYT+ L Sbjct: 203 KLMINLKKELKLTYLFITHDLASAKYICDRIAVMYLGSIVEIAKTYDIFTNPLHPYTKIL 262 Query: 257 LKSVPKIPWDGQKQRFYSLKGELPSPIDLPKGCRFQTRCTEKKAICFEKEPELTEVEKNH 316 L S+P +P K+ KGE+PS +P GCRF TRC K C + EP L EVEK Sbjct: 263 LSSIP-VPDPNIKREKILPKGEIPSATKIPSGCRFHTRCPFAKDKCSKVEPALKEVEKGR 321 Query: 317 FVSCHLV 323 FV+CH V Sbjct: 322 FVACHYV 328 Lambda K H 0.321 0.142 0.417 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 346 Number of extensions: 21 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 328 Length of database: 328 Length adjustment: 28 Effective length of query: 300 Effective length of database: 300 Effective search space: 90000 Effective search space used: 90000 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory