Align ABC transporter ATP-binding protein (characterized, see rationale)
to candidate WP_035587689.1 EK17_RS04045 ABC transporter ATP-binding protein
Query= uniprot:A0A165KC86 (260 letters) >NCBI__GCF_000744435.1:WP_035587689.1 Length = 252 Score = 196 bits (498), Expect = 4e-55 Identities = 100/248 (40%), Positives = 156/248 (62%), Gaps = 2/248 (0%) Query: 9 VLKVAGISKRFGGLQALSDVGITIKRGQVYGLIGPNGAGKTTFFNVITGLYTPDAGTFEL 68 +L++ + K FGG++A+ V + + Q+ ++GPNGAGKTT FN+ITGLY D G EL Sbjct: 6 LLRIYDVYKSFGGIRAVDGVSFDLFKKQIKAVVGPNGAGKTTLFNIITGLYKADRGKIEL 65 Query: 69 AGKPYEPTAVHEVAKAGIARTFQNIRLFAEMTALENVMVGRHIRTGSGLFGAVFRTKGFK 128 G+ H++ K GIARTFQNI+L +++T EN+ +G H + L A +K Sbjct: 66 FGEDITNCKSHKLIKKGIARTFQNIQLISDLTVFENIAIGAHHLFETNLLEAFLGL--YK 123 Query: 129 AEEAAIAKRAQELLDYVGIGKFADYKARTLSYGDQRRLEIARALATDPQLIALDEPAAGM 188 E + ++ + ++ ++ I ++ D L +G +R +EI RA+A++P+L+ LDEPAAG+ Sbjct: 124 KNEKKVFEKLKWIIRFLKIEEYVDLYPDELPFGIKRIVEIGRAIASNPKLLLLDEPAAGL 183 Query: 189 NATEKVQLRELIDRIRNDNRTILLIEHDVKLVMGLCDRVTVLDYGKQIAEGNPAEVQKNE 248 N +E QL +I R+ TILLI+HD++ V + V+D GK+IAEG P+EV +E Sbjct: 184 NESESEQLLNIIFRVWERGTTILLIDHDIEFVASCSHSIVVMDSGKKIAEGLPSEVLNDE 243 Query: 249 KVIEAYLG 256 +VI AY+G Sbjct: 244 RVIRAYIG 251 Lambda K H 0.319 0.137 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 172 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 252 Length adjustment: 24 Effective length of query: 236 Effective length of database: 228 Effective search space: 53808 Effective search space used: 53808 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory