GapMind for catabolism of small carbon sources

 

Protein WP_037572389.1 in Streptacidiphilus oryzae TH49

Annotation: NCBI__GCF_000744815.1:WP_037572389.1

Length: 386 amino acids

Source: GCF_000744815.1 in NCBI

Candidate for 49 steps in catabolism of small carbon sources

Pathway Step Score Similar to Id. Cov. Bits Other hit Other id. Other bits
putrescine catabolism potA hi PotG aka B0855, component of Putrescine porter (characterized) 44% 93% 280 Glycerol-3-phosphate-transporting ATPase, component of Inositol phosphate porter (Rodionova et al. 2013). Binds inositol phosphate with low Kd and inositol with a lower affinity 45% 260.8
D-mannitol catabolism mtlK med ABC transporter for D-mannitol and D-mannose, ATPase component (characterized) 40% 93% 246.5 PotG aka B0855, component of Putrescine porter 44% 280.0
D-sorbitol (glucitol) catabolism mtlK med ABC transporter for D-sorbitol, ATPase component (characterized) 41% 89% 241.9 PotG aka B0855, component of Putrescine porter 44% 280.0
L-arabinose catabolism xacJ med Xylose/arabinose import ATP-binding protein XacJ; EC 7.5.2.13 (characterized, see rationale) 45% 75% 239.6 PotG aka B0855, component of Putrescine porter 44% 280.0
D-maltose catabolism malK1 med MalK; aka Sugar ABC transporter, ATP-binding protein, component of The maltose, maltotriose, mannotetraose (MalE1)/maltose, maltotriose, trehalose (MalE2) porter (Nanavati et al., 2005). For MalG1 (823aas) and MalG2 (833aas), the C-terminal transmembrane domain with 6 putative TMSs is preceded by a single N-terminal TMS and a large (600 residue) hydrophilic region showing sequence similarity to MLP1 and 2 (9.A.14; e-12 & e-7) as well as other proteins (characterized) 40% 89% 231.1 PotG aka B0855, component of Putrescine porter 44% 280.0
trehalose catabolism thuK med MalK; aka Sugar ABC transporter, ATP-binding protein, component of The maltose, maltotriose, mannotetraose (MalE1)/maltose, maltotriose, trehalose (MalE2) porter (Nanavati et al., 2005). For MalG1 (823aas) and MalG2 (833aas), the C-terminal transmembrane domain with 6 putative TMSs is preceded by a single N-terminal TMS and a large (600 residue) hydrophilic region showing sequence similarity to MLP1 and 2 (9.A.14; e-12 & e-7) as well as other proteins (characterized) 40% 89% 231.1 PotG aka B0855, component of Putrescine porter 44% 280.0
D-glucosamine (chitosamine) catabolism SM_b21216 med ABC transporter for D-Glucosamine, ATPase component (characterized) 41% 84% 229.2 PotG aka B0855, component of Putrescine porter 44% 280.0
D-maltose catabolism malK_Aa med ABC-type maltose transporter (EC 7.5.2.1) (characterized) 45% 72% 228.4 PotG aka B0855, component of Putrescine porter 44% 280.0
xylitol catabolism HSERO_RS17020 med ABC-type sugar transport system, ATPase component protein (characterized, see rationale) 45% 71% 228 PotG aka B0855, component of Putrescine porter 44% 280.0
D-maltose catabolism malK med Maltose-transporting ATPase (EC 3.6.3.19) (characterized) 40% 84% 224.9 PotG aka B0855, component of Putrescine porter 44% 280.0
D-maltose catabolism malK_Bb med ABC-type maltose transport, ATP binding protein (characterized, see rationale) 41% 76% 224.6 PotG aka B0855, component of Putrescine porter 44% 280.0
D-maltose catabolism aglK med ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized) 41% 80% 220.3 PotG aka B0855, component of Putrescine porter 44% 280.0
D-maltose catabolism thuK med ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized) 41% 80% 220.3 PotG aka B0855, component of Putrescine porter 44% 280.0
sucrose catabolism aglK med ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized) 41% 80% 220.3 PotG aka B0855, component of Putrescine porter 44% 280.0
trehalose catabolism aglK med ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized) 41% 80% 220.3 PotG aka B0855, component of Putrescine porter 44% 280.0
sucrose catabolism thuK med ThuK aka RB0314 aka SMB20328, component of Trehalose/maltose/sucrose porter (trehalose inducible) (characterized) 42% 76% 214.2 PotG aka B0855, component of Putrescine porter 44% 280.0
trehalose catabolism treV med TreV, component of Trehalose porter (characterized) 43% 75% 207.6 PotG aka B0855, component of Putrescine porter 44% 280.0
D-cellobiose catabolism gtsD lo Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 40% 98% 247.7 PotG aka B0855, component of Putrescine porter 44% 280.0
D-glucose catabolism gtsD lo Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 40% 98% 247.7 PotG aka B0855, component of Putrescine porter 44% 280.0
lactose catabolism gtsD lo Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 40% 98% 247.7 PotG aka B0855, component of Putrescine porter 44% 280.0
D-maltose catabolism gtsD lo Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 40% 98% 247.7 PotG aka B0855, component of Putrescine porter 44% 280.0
D-mannose catabolism TT_C0211 lo Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 40% 98% 247.7 PotG aka B0855, component of Putrescine porter 44% 280.0
sucrose catabolism gtsD lo Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 40% 98% 247.7 PotG aka B0855, component of Putrescine porter 44% 280.0
trehalose catabolism gtsD lo Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 40% 98% 247.7 PotG aka B0855, component of Putrescine porter 44% 280.0
L-fucose catabolism SM_b21106 lo ABC transporter for L-Fucose, ATPase component (characterized) 39% 97% 243.8 PotG aka B0855, component of Putrescine porter 44% 280.0
lactose catabolism lacK lo LacK, component of Lactose porter (characterized) 38% 98% 235.3 PotG aka B0855, component of Putrescine porter 44% 280.0
L-arabinose catabolism xacK lo Xylose/arabinose import ATP-binding protein XacK; EC 7.5.2.13 (characterized, see rationale) 40% 93% 230.7 PotG aka B0855, component of Putrescine porter 44% 280.0
D-xylose catabolism gtsD lo ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized) 36% 94% 229.2 PotG aka B0855, component of Putrescine porter 44% 280.0
N-acetyl-D-glucosamine catabolism SMc02869 lo N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized) 38% 97% 228.4 PotG aka B0855, component of Putrescine porter 44% 280.0
D-glucosamine (chitosamine) catabolism SMc02869 lo N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized) 38% 97% 228.4 PotG aka B0855, component of Putrescine porter 44% 280.0
D-maltose catabolism musK lo ABC-type maltose transporter (EC 7.5.2.1) (characterized) 40% 87% 228 PotG aka B0855, component of Putrescine porter 44% 280.0
xylitol catabolism Dshi_0546 lo ABC transporter for Xylitol, ATPase component (characterized) 38% 95% 227.6 PotG aka B0855, component of Putrescine porter 44% 280.0
D-maltose catabolism malK_Sm lo MalK, component of Maltose/Maltotriose/maltodextrin (up to 7 glucose units) transporters MalXFGK (MsmK (3.A.1.1.28) can probably substitute for MalK; Webb et al., 2008) (characterized) 36% 99% 223 PotG aka B0855, component of Putrescine porter 44% 280.0
trehalose catabolism malK lo MalK, component of Maltose/Maltotriose/maltodextrin (up to 7 glucose units) transporters MalXFGK (MsmK (3.A.1.1.28) can probably substitute for MalK; Webb et al., 2008) (characterized) 36% 99% 223 PotG aka B0855, component of Putrescine porter 44% 280.0
D-cellobiose catabolism SMc04256 lo ABC transporter for D-Cellobiose and D-Salicin, ATPase component (characterized) 36% 97% 216.5 PotG aka B0855, component of Putrescine porter 44% 280.0
D-cellobiose catabolism msiK lo MsiK protein, component of The cellobiose/cellotriose (and possibly higher cellooligosaccharides), CebEFGMsiK [MsiK functions to energize several ABC transporters including those for maltose/maltotriose and trehalose] (characterized) 37% 91% 216.5 PotG aka B0855, component of Putrescine porter 44% 280.0
D-cellobiose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 38% 87% 215.3 PotG aka B0855, component of Putrescine porter 44% 280.0
D-glucose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 38% 87% 215.3 PotG aka B0855, component of Putrescine porter 44% 280.0
lactose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 38% 87% 215.3 PotG aka B0855, component of Putrescine porter 44% 280.0
D-maltose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 38% 87% 215.3 PotG aka B0855, component of Putrescine porter 44% 280.0
sucrose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 38% 87% 215.3 PotG aka B0855, component of Putrescine porter 44% 280.0
trehalose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 38% 87% 215.3 PotG aka B0855, component of Putrescine porter 44% 280.0
D-galactose catabolism PfGW456L13_1897 lo ABC transporter for D-Galactose and D-Glucose, ATPase component (characterized) 35% 97% 213 PotG aka B0855, component of Putrescine porter 44% 280.0
glycerol catabolism glpT lo GlpT, component of Glycerol uptake porter, GlpSTPQV (characterized) 38% 78% 186 PotG aka B0855, component of Putrescine porter 44% 280.0
L-arabinose catabolism araV lo AraV, component of Arabinose, fructose, xylose porter (characterized) 34% 78% 181.4 PotG aka B0855, component of Putrescine porter 44% 280.0
D-fructose catabolism araV lo AraV, component of Arabinose, fructose, xylose porter (characterized) 34% 78% 181.4 PotG aka B0855, component of Putrescine porter 44% 280.0
sucrose catabolism araV lo AraV, component of Arabinose, fructose, xylose porter (characterized) 34% 78% 181.4 PotG aka B0855, component of Putrescine porter 44% 280.0
D-xylose catabolism araV lo AraV, component of Arabinose, fructose, xylose porter (characterized) 34% 78% 181.4 PotG aka B0855, component of Putrescine porter 44% 280.0
glycerol catabolism glpS lo ABC transporter for Glycerol, ATPase component 1 (characterized) 33% 96% 176.8 PotG aka B0855, component of Putrescine porter 44% 280.0

Sequence Analysis Tools

View WP_037572389.1 at NCBI

Find papers: PaperBLAST

Find functional residues: SitesBLAST

Search for conserved domains

Find the best match in UniProt

Compare to protein structures

Predict transmenbrane helices: Phobius

Predict protein localization: PSORTb

Find homologs in fast.genomics

Fitness BLAST: loading...

Sequence

MSTQAGYSTDVLDGERGDLRLTGLTKKFGSFTAVDGVDLTIAQGSFFALLGASGCGKTTT
LRMISGLEAPTAGRIHLGDQDVTDRKPYRRPVNTVFQNYALFPHLDIFENVAFGLRRRGI
RSVKKPVEDMLDLVELGHLARRKPTQLSGGQQQRIALARALINQPQVLLLDEPLGALDLK
LRRQMQIELKRIQLEVGLTFVHVTHDQEEAMTMADTIAVMNHGRIEQLGSPAELYENPNT
TFVANFLGQSNLIAGTVESVSGDVVQVAAHGRSLALPAARCRTTSGPVILGVRPEKVRIA
KTEAEVPSGANHLTGKVTDASFIGVSTQYLVELPSGEELAVFEQNTGQEIQRPGAEVVVH
WDPSQGFGLDGEQDIQAGADADEEAA

This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory