GapMind for catabolism of small carbon sources

 

Protein WP_084704012.1 in Streptacidiphilus oryzae TH49

Annotation: NCBI__GCF_000744815.1:WP_084704012.1

Length: 406 amino acids

Source: GCF_000744815.1 in NCBI

Candidate for 48 steps in catabolism of small carbon sources

Pathway Step Score Similar to Id. Cov. Bits Other hit Other id. Other bits
D-cellobiose catabolism gtsD med Sugar ABC transporter ATP-binding protein (characterized, see rationale) 41% 93% 230.7 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 40% 239.6
D-glucose catabolism gtsD med Sugar ABC transporter ATP-binding protein (characterized, see rationale) 41% 93% 230.7 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 40% 239.6
lactose catabolism gtsD med Sugar ABC transporter ATP-binding protein (characterized, see rationale) 41% 93% 230.7 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 40% 239.6
D-maltose catabolism gtsD med Sugar ABC transporter ATP-binding protein (characterized, see rationale) 41% 93% 230.7 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 40% 239.6
sucrose catabolism gtsD med Sugar ABC transporter ATP-binding protein (characterized, see rationale) 41% 93% 230.7 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 40% 239.6
trehalose catabolism gtsD med Sugar ABC transporter ATP-binding protein (characterized, see rationale) 41% 93% 230.7 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 40% 239.6
D-cellobiose catabolism msiK med MsiK protein, component of The cellobiose/cellotriose (and possibly higher cellooligosaccharides), CebEFGMsiK [MsiK functions to energize several ABC transporters including those for maltose/maltotriose and trehalose] (characterized) 41% 93% 223.8 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 40% 239.6
D-sorbitol (glucitol) catabolism mtlK med ABC transporter for D-Sorbitol, ATPase component (characterized) 44% 79% 222.2 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 40% 239.6
L-fucose catabolism SM_b21106 med ABC transporter for L-Fucose, ATPase component (characterized) 40% 90% 221.1 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 40% 239.6
lactose catabolism lacK med LacK, component of Lactose porter (characterized) 44% 79% 214.9 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 40% 239.6
D-glucosamine (chitosamine) catabolism SM_b21216 med ABC transporter for D-Glucosamine, ATPase component (characterized) 43% 81% 213.8 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 40% 239.6
N-acetyl-D-glucosamine catabolism SMc02869 med N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized) 41% 89% 210.7 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 40% 239.6
D-glucosamine (chitosamine) catabolism SMc02869 med N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized) 41% 89% 210.7 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 40% 239.6
D-cellobiose catabolism aglK' med Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 41% 79% 206.8 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 40% 239.6
D-glucose catabolism aglK' med Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 41% 79% 206.8 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 40% 239.6
lactose catabolism aglK' med Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 41% 79% 206.8 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 40% 239.6
D-maltose catabolism aglK med Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 41% 79% 206.8 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 40% 239.6
D-maltose catabolism aglK' med Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 41% 79% 206.8 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 40% 239.6
sucrose catabolism aglK med Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 41% 79% 206.8 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 40% 239.6
sucrose catabolism aglK' med Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 41% 79% 206.8 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 40% 239.6
trehalose catabolism aglK med Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 41% 79% 206.8 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 40% 239.6
trehalose catabolism aglK' med Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 41% 79% 206.8 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 40% 239.6
xylitol catabolism Dshi_0546 med ABC transporter for Xylitol, ATPase component (characterized) 47% 70% 206.5 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 40% 239.6
D-maltose catabolism musK med ABC-type maltose transporter (EC 7.5.2.1) (characterized) 40% 76% 203.4 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 40% 239.6
D-mannitol catabolism mtlK med SmoK aka POLK, component of Hexitol (glucitol; mannitol) porter (characterized) 44% 70% 203 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 40% 239.6
L-arabinose catabolism xacJ med Xylose/arabinose import ATP-binding protein XacJ; EC 7.5.2.13 (characterized, see rationale) 40% 77% 195.7 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 40% 239.6
xylitol catabolism HSERO_RS17020 lo ABC-type sugar transport system, ATPase component protein (characterized, see rationale) 38% 99% 226.9 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 40% 239.6
D-maltose catabolism malK_Bb lo ABC-type maltose transport, ATP binding protein (characterized, see rationale) 38% 90% 218.8 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 40% 239.6
D-maltose catabolism malK1 lo MalK; aka Sugar ABC transporter, ATP-binding protein, component of The maltose, maltotriose, mannotetraose (MalE1)/maltose, maltotriose, trehalose (MalE2) porter (Nanavati et al., 2005). For MalG1 (823aas) and MalG2 (833aas), the C-terminal transmembrane domain with 6 putative TMSs is preceded by a single N-terminal TMS and a large (600 residue) hydrophilic region showing sequence similarity to MLP1 and 2 (9.A.14; e-12 & e-7) as well as other proteins (characterized) 37% 98% 211.1 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 40% 239.6
trehalose catabolism thuK lo MalK; aka Sugar ABC transporter, ATP-binding protein, component of The maltose, maltotriose, mannotetraose (MalE1)/maltose, maltotriose, trehalose (MalE2) porter (Nanavati et al., 2005). For MalG1 (823aas) and MalG2 (833aas), the C-terminal transmembrane domain with 6 putative TMSs is preceded by a single N-terminal TMS and a large (600 residue) hydrophilic region showing sequence similarity to MLP1 and 2 (9.A.14; e-12 & e-7) as well as other proteins (characterized) 37% 98% 211.1 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 40% 239.6
sucrose catabolism thuK lo ABC transporter (characterized, see rationale) 35% 99% 205.7 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 40% 239.6
D-maltose catabolism thuK lo Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 37% 95% 204.5 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 40% 239.6
D-mannose catabolism TT_C0211 lo Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 37% 95% 204.5 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 40% 239.6
D-cellobiose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 39% 80% 199.9 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 40% 239.6
D-galactose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 39% 80% 199.9 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 40% 239.6
D-glucose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 39% 80% 199.9 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 40% 239.6
lactose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 39% 80% 199.9 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 40% 239.6
D-maltose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 39% 80% 199.9 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 40% 239.6
D-mannose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 39% 80% 199.9 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 40% 239.6
sucrose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 39% 80% 199.9 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 40% 239.6
trehalose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 39% 80% 199.9 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 40% 239.6
D-maltose catabolism malK lo Maltose-transporting ATPase (EC 3.6.3.19) (characterized) 40% 77% 198 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 40% 239.6
L-arabinose catabolism araV lo AraV, component of Arabinose, fructose, xylose porter (characterized) 42% 65% 193 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 40% 239.6
D-fructose catabolism araV lo AraV, component of Arabinose, fructose, xylose porter (characterized) 42% 65% 193 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 40% 239.6
sucrose catabolism araV lo AraV, component of Arabinose, fructose, xylose porter (characterized) 42% 65% 193 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 40% 239.6
D-xylose catabolism araV lo AraV, component of Arabinose, fructose, xylose porter (characterized) 42% 65% 193 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 40% 239.6
trehalose catabolism treV lo TreV, component of Trehalose porter (characterized) 43% 69% 189.5 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 40% 239.6
glycerol catabolism glpS lo GlpS, component of Glycerol uptake porter, GlpSTPQV (characterized) 37% 78% 166.4 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 40% 239.6

Sequence Analysis Tools

View WP_084704012.1 at NCBI

Find papers: PaperBLAST

Find functional residues: SitesBLAST

Search for conserved domains

Find the best match in UniProt

Compare to protein structures

Predict transmenbrane helices: Phobius

Predict protein localization: PSORTb

Find homologs in fast.genomics

Fitness BLAST: loading...

Sequence

MTPAQLHVEGLGKDYAGKTALHQVDFTVAPGRFMVLLGPSGSGKTTLLRCLAGIERPDRG
SIRLGGRVLAQDRTHLPPDRRDLAMVFQDYALWPHMTAAANVGFALRRRRPDRAAAAREV
AAVLEQVGLGHRTDHYPHQLSGGEQQRVALARALVARPGLLLFDEPLSNLDADLRERLRV
EIARLTRESGATVVYITHDQAEAFALADEVGVLLDGRLAQLGSPEAIYRRPATASVARFT
GVSAEFRGRTGGAVGGEGGQVLVQTDAGPLRATVSEAVAADRAVRVMVRPDAVGLRPADP
SGNDARPGPAGGPLGRVVDAAFRGRGYDHVVELTDGTLLTGVFDRSAHPRGSDVRLVLDP
EGCLAFPEPPLVPAGSVRSRVPAVDAAAGAAPSGSGDRTPLIQEAQ

This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory